![Western Blot: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Analysis in human heart tissue.](http://images.novusbio.com/fullsize/Troponin-T-Type-2-cardiac-Antibody-Western-Blot-NBP1-88069-img0009.jpg "Western Blot: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Analysis in human heart tissue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IEEVVEEYEEEEQEEAAVEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TNNT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Troponin T Type 2 (cardiac) Antibody (NBP1-88069)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TNNT2 |
![Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human skeletal muscle shows very weak positivity in myocytes.](http://images.novusbio.com/fullsize/Troponin-T-Type-2-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP1-88069-img0015.jpg "Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human skeletal muscle shows very weak positivity in myocytes.")
![Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Analysis in human heart muscle and liver tissues. Corresponding TNNT2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Troponin-T-Type-2-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP1-88069-img0011.jpg "Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Analysis in human heart muscle and liver tissues. Corresponding TNNT2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/Troponin-T-Type-2-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP1-88069-img0012.jpg "Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/Troponin-T-Type-2-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP1-88069-img0013.jpg "Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Troponin-T-Type-2-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP1-88069-img0014.jpg "Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human heart muscle, kidney, liver and skeletal muscle using Anti-TNNT2 antibody (A) NBP1-88069 shows similar protein distribution across tissues to independent antibody NBP1-88070 (B).](http://images.novusbio.com/fullsize/Troponin-T-Type-2-cardiac-Antibody-Immunohistochemistry-Paraffin-NBP1-88069-img0016.jpg "Immunohistochemistry-Paraffin: Troponin T Type 2 (cardiac) Antibody [NBP1-88069] - Staining of human heart muscle, kidney, liver and skeletal muscle using Anti-TNNT2 antibody (A) NBP1-88069 shows similar protein distribution across tissues to independent antibody NBP1-88070 (B).")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")