Home » Troponin C (cardiac) » Troponin C (cardiac) Proteins » Troponin C (cardiac) Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Troponin C (cardiac) Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Troponin C (cardiac) Recombinant Protein Antigen (NBP2-55151PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Troponin C (cardiac) Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Troponin C (cardiac).

Source: E. coli

Amino Acid Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNNC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55151.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Troponin C (cardiac) Recombinant Protein Antigen

  • cardiac troponin C
  • CMD1Z
  • CMH13
  • slow twitch skeletal/cardiac muscle troponin C
  • TNC
  • TN-C
  • TNNC
  • troponin C type 1 (slow)
  • troponin C, slow skeletal and cardiac muscles
  • troponin C, slow
  • troponin C1, slow

Background

Troponin I is part of a heteromeric complex playing an important role in the regulation of skeletal and cardiac muscle contraction. It consists of three subunits, troponin I (TnI), troponin T (TnT) and troponin C (TnC). Each subunit is responsible for part of troponin complex function. TnI inhibits ATPase activity of acto myosin and TnT and TnI are present in cardiac muscles in different forms than in skeletal muscles. Only one tissue specific isoform of TnI is described for cardiac muscle tissue (cTnI) and this is expressed only in myocardium.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Troponin T type 1
(slow skeletal) Antib ...
H00007138-B01P
Western Blot Troponin T type 1 (slow skeletal) Antibody
Western Blot Troponin T type 1 (slow skeletal) Antibody
Western Blot Troponin T type 1 (slow skeletal) Antibody
(1 Review)
(2 Publications)
Species: Hu, In
Applications: WB
Troponin I Type 3
(cardiac) Antibody (2 ...
NBP2-35336
Western Blot Troponin I Type 3 (cardiac) Antibody (2C9) - BSA Free
Immunohistochemistry-Paraffin Troponin I Type 3 (cardiac) Antibody (2C9) - BSA Free
Immunohistochemistry-Paraffin Troponin I Type 3 (cardiac) Antibody (2C9) - BSA Free
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
(1 Review)
(158 Publications)
Species: All-Multi
Applications: ICC, IHC, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
MMP-2 [HRP]
MMP200
N/A MMP-2 [HRP]
N/A MMP-2 [HRP]
(101 Publications)
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Tenascin X
Antibody [Unconjugate
AF6999
Western Blot Tenascin X Antibody [Unconjugated]
Immunohistochemistry Tenascin X Antibody [Unconjugated]
Simple Western Tenascin X Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, Simple Western, WB
Mcl-1 Antibody
NB100-56146
Western Blot Mcl-1 Antibody
Immunohistochemistry-Paraffin Mcl-1 Antibody
(1 Review)
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
Tenascin R Antibody
AF3865
Immunohistochemistry Tenascin R Antibody
(1 Review)
(11 Publications)
Species: Hu
Applications: IHC, WB
MMP-9 [HRP]
DMP900
N/A MMP-9 [HRP]
N/A MMP-9 [HRP]
(219 Publications)
Species: Hu
Applications: ELISA
TBP like protein
TLP Antibody
NBP2-49671
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Troponin C (cardiac) Recombinant Protein Antigen (NBP2-55151PEP) (0)

There are no publications for Troponin C (cardiac) Recombinant Protein Antigen (NBP2-55151PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Troponin C (cardiac) Recombinant Protein Antigen (NBP2-55151PEP) (0)

There are no reviews for Troponin C (cardiac) Recombinant Protein Antigen (NBP2-55151PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Troponin C (cardiac) Recombinant Protein Antigen (NBP2-55151PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Troponin C (cardiac) Products

Research Areas for Troponin C (cardiac) Recombinant Protein Antigen (NBP2-55151PEP)

Find related products by research area.

Blogs on Troponin C (cardiac)

There are no specific blogs for Troponin C (cardiac), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Troponin C (cardiac) Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TNNC1