Home » ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 » ST8SIA4 Peptides and Proteins » ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Protein (NBP2-13393PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST8SIA4.

Source: E. coli

Amino Acid Sequence: RTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ST8SIA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13393.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen

  • Alpha-2,8-sialyltransferase 8D
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase
  • CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase
  • EC 2.4.99
  • EC 2.4.99.-
  • polysialyltransferase-1
  • PST1
  • PST1MGC61459
  • PSTMGC34450
  • sialyltransferase 8 (alpha-2, 8-polysialytransferase) D
  • Sialyltransferase 8D
  • Sialytransferase St8Sia IV
  • SIAT8D
  • SIAT8-D
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  • ST8SIA4
  • ST8SIAIV
  • ST8SIA-IV

Background

The protein encoded by the ST8SIA4 gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ST8
alpha-2,8-Sialyltrans ...
AF6590
Western Blot ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
Immunohistochemistry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NCAM-1/CD56
Antibody [Unconjugate
AF2408
Western Blot NCAM-1/CD56 Antibody [Unconjugated]
Simple Western NCAM-1/CD56 Antibody [Unconjugated]
Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
SMC3 Antibody
NB100-207
Unknown SMC3 Antibody
Western Blot SMC3 Antibody
Immunohistochemistry-Paraffin SMC3 Antibody
(9 Publications)
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Bim Antibody - BSA
Free
NBP1-76963
Western Blot Bim Antibody - BSA Free
Western Blot Bim Antibody - BSA Free
Western Blot Bim Antibody - BSA Free
(8 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
PSAT1 Antibody
NBP1-32920
Western Blot PSAT1 Antibody
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7)
Immunohistochemistry PLAG1 Antibody (3B7)
ELISA PLAG1 Antibody (3B7)
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AKAP4 Antibody
NBP1-89165
Immunohistochemistry-Paraffin AKAP4 Antibody
Immunohistochemistry-Paraffin AKAP4 Antibody
Immunohistochemistry-Paraffin AKAP4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
SUR1 Antibody
(S289-16)
NBP2-59320
Western Blot SUR1 Antibody (S289-16)
Immunocytochemistry/ Immunofluorescence SUR1 Antibody (S289-16)
Western Blot SUR1 Antibody (S289-16)
(2 Reviews)
(4 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Cav1.2 Antibody
(S57)
NBP1-22439
Immunocytochemistry/ Immunofluorescence Cav1.2 Antibody (S57)
Western Blot Cav1.2 Antibody (S57)
Immunohistochemistry Cav1.2 Antibody (S57)
(3 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Protein (NBP2-13393PEP) (0)

There are no publications for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Protein (NBP2-13393PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Protein (NBP2-13393PEP) (0)

There are no reviews for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Protein (NBP2-13393PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Protein (NBP2-13393PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Products

Research Areas for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Protein (NBP2-13393PEP)

Find related products by research area.

Blogs on ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4

There are no specific blogs for ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ST8SIA4