Home » ST6GALNAC3 » ST6GALNAC3 Proteins » ST6GALNAC3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ST6GALNAC3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ST6GALNAC3 Recombinant Protein Antigen (NBP2-56726PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ST6GALNAC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST6GALNAC3.

Source: E. coli

Amino Acid Sequence: EANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ST6GALNAC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56726.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ST6GALNAC3 Recombinant Protein Antigen

  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III
  • EC 2.4.99.-
  • EC 2.4.99.7
  • FLJ13669
  • FLJ27239
  • GalNAc alpha-2,6-sialyltransferase III
  • PRO7177
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C
  • Sialyltransferase 7C
  • SIAT7C
  • SIAT7-C
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3
  • ST6GalNAc III
  • ST6GALNACIII
  • STY

Background

ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids (Lee et al., 1999 [PubMed 10207017]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CLK1 Antibody
NBP2-87194
Western Blot CLK1 Antibody
Western Blot CLK1 Antibody
(1 Review)
Species: Hu
Applications: WB
SF2 Antibody
NBP2-20324
Western Blot SF2 Antibody
Western Blot SF2 Antibody
Immunohistochemistry-Paraffin SF2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
gamma-Synuclein
Antibody
NBP1-89996
Western Blot gamma-Synuclein Antibody
Immunohistochemistry-Paraffin gamma-Synuclein Antibody
Immunohistochemistry gamma-Synuclein Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Secretin R Antibody
NBP1-86125
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
RNPS1 Antibody
(7G8)
H00010921-M05
Western Blot RNPS1 Antibody (7G8)
Western Blot RNPS1 Antibody (7G8)
Western Blot RNPS1 Antibody (7G8)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
ST6GALNAC4
[Unconjugated]
6876-GT
ST6GALNAC4 [Unconjugated]
Species: Hu
Applications: EnzAct
ARSF Antibody
NBP3-41367
ARSF Antibody
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
S5a/Angiocidin
Antibody
NBP2-19952
Knockdown Validated S5a/Angiocidin Antibody
Western Blot S5a/Angiocidin Antibody
Western Blot S5a/Angiocidin Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, KD, WB
LMP7/PSMB8
Antibody (1B3)
H00005696-M01
Western Blot LMP7/PSMB8 Antibody (1B3)
Immunocytochemistry/ Immunofluorescence LMP7/PSMB8 Antibody (1B3)
Immunohistochemistry-Paraffin LMP7/PSMB8 Antibody (1B3)
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
SRPK1 Antibody
(6H5)
H00006732-M01
Immunohistochemistry-Paraffin SRPK1 Antibody (6H5)
Sandwich ELISA SRPK1 Antibody (6H5)
Western Blot SRPK1 Antibody (6H5)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(840 Publications)
Species: Hu
Applications: BA
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ST6 GalNAc
alpha-2,6-sialyltrans ...
MAB6715
Western Blot ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody (719526)
Species: Hu
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
Cytokeratin 19
Antibody - BSA Free
NB100-687
Flow Cytometry Cytokeratin 19 Antibody - BSA Free
Western Blot Cytokeratin 19 Antibody - BSA Free
Immunohistochemistry Cytokeratin 19 Antibody - BSA Free
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
SNRP70 Antibody
NBP1-57487
Immunohistochemistry-Paraffin SNRP70 Antibody
Western Blot SNRP70 Antibody
Western Blot SNRP70 Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
PMP22 Antibody
(Hu1) - Azide and BSA ...
NBP2-80913
Immunohistochemistry PMP22 Antibody (Hu1) - Azide and BSA Free
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB

Publications for ST6GALNAC3 Recombinant Protein Antigen (NBP2-56726PEP) (0)

There are no publications for ST6GALNAC3 Recombinant Protein Antigen (NBP2-56726PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6GALNAC3 Recombinant Protein Antigen (NBP2-56726PEP) (0)

There are no reviews for ST6GALNAC3 Recombinant Protein Antigen (NBP2-56726PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ST6GALNAC3 Recombinant Protein Antigen (NBP2-56726PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ST6GALNAC3 Products

Blogs on ST6GALNAC3

There are no specific blogs for ST6GALNAC3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ST6GALNAC3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ST6GALNAC3