Home » SRM » SRM Proteins » SRM Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SRM Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SRM Protein (NBP1-80726PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SRM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRM.

Source: E. coli

Amino Acid Sequence: FKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SRM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80726.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SRM Recombinant Protein Antigen

  • EC 2.5.1
  • EC 2.5.1.16
  • Putrescine aminopropyltransferase
  • SPDSY
  • spermidine synthase
  • spermidine synthase-1
  • SPS1PAPT
  • SRML1

Background

The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells. The human complex consists of seven subunits which include the actin related proteins Arp2 and Arp3, and five others referred to as p41-Arc, p34-Arc, p21-Arc, p20-Arc, and p16-Arc (p omplex) (1). These proteins localize in the cytoplasm of fibroblasts that lack lamellipodia, but are enriched in lamellipodia on stimulation with serum or platelet-derived growth factor. A dynamic role for this complex in the organization of the actin cytoskeleton has been suggested (2). p16-Arc has been found to be a globular alpha-helical subunit (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ornithine
Decarboxylase Antibod ...
NBP2-32887
Immunohistochemistry-Paraffin Ornithine Decarboxylase Antibody (ODC1/485)
Immunocytochemistry/ Immunofluorescence Ornithine Decarboxylase Antibody (ODC1/485)
Western Blot Ornithine Decarboxylase Antibody (ODC1/485)
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Spermine synthase
Antibody (OTI3C9)
NBP2-00900
Western Blot Spermine synthase Antibody (OTI3C9)
Flow Cytometry Spermine synthase Antibody (OTI3C9)
Flow Cytometry Spermine synthase Antibody (OTI3C9)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Histatin 3
Antibody (4G9)
H00003347-M01
Sandwich ELISA Histatin 3 Antibody (4G9)
Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
HAI-2/SPINT2
Antibody [Unconjugate
AF1107
HAI-2/SPINT2 Antibody [Unconjugated]
(3 Publications)
Species: Mu
Applications: IHC, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
Calretinin Antibody
NBP1-88220
Immunocytochemistry/ Immunofluorescence Calretinin Antibody
Western Blot Calretinin Antibody
Immunohistochemistry-Paraffin Calretinin Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CD21 Antibody
(SC0681)
NBP2-67605
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunohistochemistry-Paraffin CD21 Antibody (SC0681)
(1 Publication)
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
DHRS4 Antibody
NBP2-98675
Immunohistochemistry-Paraffin DHRS4 Antibody
Immunohistochemistry-Paraffin DHRS4 Antibody
Western Blot DHRS4 Antibody
Species: Hu
Applications: IHC-P, IP, WB
CRIPTO Antibody
[Unconjugated]
AF1538
Immunocytochemistry CRIPTO Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: Block, ICC, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
SLC25A21 Antibody
NBP1-82493
Immunohistochemistry-Paraffin SLC25A21 Antibody
Western Blot SLC25A21 Antibody
Species: Hu
Applications: IHC, IHC-P, WB

Trappin-2/Elafin/Skalp
DY1747
N/A Trappin-2/Elafin/Skalp [Biotin]
(16 Publications)
Species: Hu
Applications: ELISA
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Nbs1 Antibody
NB100-143
Western Blot Nbs1 Antibody
Western Blot Nbs1 Antibody
Immunocytochemistry/ Immunofluorescence Nbs1 Antibody
(8 Reviews)
(204 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
NM23-H1 Antibody
NBP1-80992
Immunohistochemistry-Paraffin NM23-H1 Antibody
Immunohistochemistry-Paraffin NM23-H1 Antibody
Immunohistochemistry-Paraffin NM23-H1 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
SIM2 Antibody
NBP1-68864
Western Blot SIM2 Antibody
(1 Publication)
Species: Mu
Applications: PEP-ELISA, WB

Publications for SRM Protein (NBP1-80726PEP) (0)

There are no publications for SRM Protein (NBP1-80726PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRM Protein (NBP1-80726PEP) (0)

There are no reviews for SRM Protein (NBP1-80726PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SRM Protein (NBP1-80726PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SRM Products

Array NBP1-80726PEP

Research Areas for SRM Protein (NBP1-80726PEP)

Find related products by research area.

Blogs on SRM

There are no specific blogs for SRM, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Nbs1 Antibody
NB100-143
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
NOD2 Antibody (2D9) - BSA Free
NB100-524

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SRM Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SRM