Home » SFPQ » SFPQ Proteins » SFPQ Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SFPQ Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SFPQ Recombinant Protein Antigen (NBP2-48876PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SFPQ Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SFPQ.

Source: E. coli

Amino Acid Sequence: IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SFPQ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48876.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SFPQ Recombinant Protein Antigen

  • 100 kDa DNA-pairing protein
  • DNA-binding p52/p100 complex, 100 kDa subunit
  • hPOMp100
  • polypyrimidine tract binding protein associated
  • polypyrimidine tract-binding protein-associated splicing factor
  • Polypyrimidine tract-binding protein-associated-splicing factor
  • PSFPOMP100
  • PTB-associated splicing factor
  • PTB-associated-splicing factor
  • splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated)
  • splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated)
  • splicing factor proline/glutamine-rich
  • splicing factor, proline- and glutamine-rich

Background

PSF/SFPQ is a multifunctional protein know to participate in a variety of nuclear processes and may function to link transcription and pre-mRNA processing. PSF/SFPQ bears an RNA recognition motif (RRM) further indicating its role in post-transcriptional processes. PSF has been shown to associate with p54nrb/NonO to modulate androgen receptor-mediated transcription. Additionally, it has recently been show to associate with XRN2 and p54nrb/NonO to facilitate pre-mRNA 3' processing and transcription termination. Alternate names for PSF/SFPQ include polypyrimidine tract-binding protein-associated-splicing factor, PTB-associated-splicing factor, splicing factor proline-and glutamine-rich, and POMP100.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NONO Antibody
NB100-1556
Western Blot NONO Antibody
Immunohistochemistry-Paraffin NONO Antibody
Immunocytochemistry/ Immunofluorescence NONO Antibody
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
FKBP51/FKBP5
Antibody [Unconjugate
AF4094
Western Blot FKBP51/FKBP5 Antibody [Unconjugated]
Simple Western FKBP51/FKBP5 Antibody [Unconjugated]
Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Ets-1 Antibody
[Unconjugated]
AF7284
Western Blot Ets-1 Antibody [Unconjugated]
Immunohistochemistry Ets-1 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, WB
IFIT2 Antibody
NBP1-31164
Western Blot IFIT2 Antibody
Western Blot IFIT2 Antibody
Western Blot IFIT2 Antibody
(2 Reviews)
(5 Publications)
Species: Hu
Applications: ICC/IF, WB
DDX6 Antibody
NB200-191
Immunoprecipitation DDX6 Antibody
Immunohistochemistry-Paraffin DDX6 Antibody
Immunocytochemistry/ Immunofluorescence DDX6 Antibody
(1 Review)
(44 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Splicing factor,
arginine/serine-rich ...
NBP1-87381
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PSPC1 Antibody
NBP1-83801
Immunohistochemistry-Paraffin PSPC1 Antibody
Immunohistochemistry-Paraffin PSPC1 Antibody
Immunohistochemistry-Paraffin PSPC1 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
FUS Antibody
NB100-565
Immunohistochemistry-Paraffin FUS Antibody
Immunohistochemistry-Paraffin FUS Antibody
Western Blot FUS Antibody
(4 Reviews)
(31 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(213 Publications)
Species: Hu
Applications: BA
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
SF2 Antibody
NBP2-20324
Western Blot SF2 Antibody
Western Blot SF2 Antibody
Immunohistochemistry-Paraffin SF2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IGFBP-rp1/IGFBP-7
Antibody [Unconjugate ...
AF1334
Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]
Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
S5a/Angiocidin
Antibody
NBP2-19952
Knockdown Validated S5a/Angiocidin Antibody
Western Blot S5a/Angiocidin Antibody
Western Blot S5a/Angiocidin Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, KD, WB
ARSF Antibody -
BSA Free
NBP3-04502
Immunocytochemistry/ Immunofluorescence ARSF Antibody - BSA Free
Species: Hu
Applications: ICC/IF, WB
PTBP1 Antibody
(3H8)
H00005725-M01
Western Blot PTBP1 Antibody (3H8)
Western Blot PTBP1 Antibody (3H8)
Western Blot PTBP1 Antibody (3H8)
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
HDAC1 Antibody
NB100-56340
Knockout Validated HDAC1 Antibody
Simple Western HDAC1 Antibody
Western Blot HDAC1 Antibody
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
PTBP2 Antibody
NBP2-19997
Western Blot PTBP2 Antibody
Immunohistochemistry-Paraffin PTBP2 Antibody
Western Blot PTBP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for SFPQ Recombinant Protein Antigen (NBP2-48876PEP) (0)

There are no publications for SFPQ Recombinant Protein Antigen (NBP2-48876PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFPQ Recombinant Protein Antigen (NBP2-48876PEP) (0)

There are no reviews for SFPQ Recombinant Protein Antigen (NBP2-48876PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SFPQ Recombinant Protein Antigen (NBP2-48876PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SFPQ Products

Research Areas for SFPQ Recombinant Protein Antigen (NBP2-48876PEP)

Find related products by research area.

Blogs on SFPQ

There are no specific blogs for SFPQ, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SFPQ Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SFPQ