Home » Serpin F2/alpha 2-Antiplasmin » Serpin F2/alpha 2-Antiplasmin Proteins » Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINF2.

Source: E. coli

Amino Acid Sequence: VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SERPINF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90305.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen

  • AAPclade F (alpha-2 antiplasmin
  • alpha 2-Antiplasmin
  • Alpha-2-AP
  • Alpha-2-PI
  • Alpha-2-plasmin inhibitor
  • pigment epithelium derived factor), member 2
  • Serpin F2
  • serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epitheliumderived factor), member 2

Background

Identification in human milk of complexes of matriptase with ATIII, A1AT, or A2AP, provides evidence that the proteolytic activity of matriptase, from cells that express no or low levels of HAI-1, may be controlled by secreted serpins. Sequencing analysis revealed the presence of two alpha2-PI gene variations, both in the second half of exon 10: a frameshift mutation and a G to A transition at nucleotide 11337 in codon 407. Observational study of gene-disease association. (HuGE Navigator). Thrombin activatable fibrinolysis inhibitor and alpha(2)-antiplasmin are not markers for recanalization in patients with ischemic stroke treated with recombinant tissue-type plasminogen activator. Fibrinolysis is amplified by converting alpha-antiplasmin from a plasmin inhibitor to a substrate. Hydroxyethyl starch (HES) dilution enhances fibrinolysis by diminishing alpha2-antiplasmin-plasmin interactions. the Arg6Trp polymorphism may play a significant role in governing the long-term deposition/removal of intravascular fibrin. TAFIa, PAI-1 and alpha-antiplasmin: complementary roles in regulating lysis of thrombi and plasma clots. Alpha2-antiplasmin has an important role in acute pulmonary embolism. Multiple Lys residues within alpha 2-antiplasmin contribute, perhaps in a zipper-like fashion, to its binding to the in-tandem, multikringle array that configures the plasmin heavy chain. alpha2-antiplasmin induction inhibits E-cadherin processing mediated by the plasminogen activator/plasmin system, leading to suppression of progression of oral squamous cell carcinoma via upregulation of cell-cell adhesion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Plasminogen
Antibody
NB600-930
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
Serpin
C1/Antithrombin-III A ...
AF1267
Serpin C1/Antithrombin-III Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: IP, Neut, WB
t-Plasminogen
Activator/tPA [HRP]
DTPA00
N/A t-Plasminogen Activator/tPA [HRP]
N/A t-Plasminogen Activator/tPA [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
Serpin E1/PAI-1
Antibody - BSA Free
NBP1-19773
Western Blot Serpin E1/PAI-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Serpin E1/PAI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin E1/PAI-1 Antibody - BSA Free
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]
(12 Publications)
Species: Hu
Applications: EnzAct
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin Antibody
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin Antibody
Western Blot Coagulation Factor II/Thrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
(53 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
ATAT1 Antibody
NBP2-48990
Immunocytochemistry/ Immunofluorescence ATAT1 Antibody
Immunohistochemistry-Paraffin ATAT1 Antibody
Immunohistochemistry-Paraffin ATAT1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
NBP1-79286
Western Blot TAT Antibody
(1 Review)
Species: Rt
Applications: WB

alpha-N-acetylglucosam ...
NBP1-31555
Immunocytochemistry/ Immunofluorescence alpha-N-acetylglucosaminidase/NAGLU Antibody
Immunocytochemistry/ Immunofluorescence alpha-N-acetylglucosaminidase/NAGLU Antibody
Immunohistochemistry-Paraffin alpha-N-acetylglucosaminidase/NAGLU Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NAG Antibody - BSA
Free
NBP2-93277
Western Blot NAG Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NAG Antibody - BSA Free
Species: Hu, Rt
Applications: ICC/IF, WB
SCN7A Antibody
NB100-81029
Immunohistochemistry-Paraffin SCN7A Antibody
Immunocytochemistry/ Immunofluorescence SCN7A Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB
PAG3 Antibody
NBP2-24614
Western Blot PAG3 Antibody
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
Reg3A Antibody
NBP2-24763
Western Blot Reg3A Antibody
Immunohistochemistry-Paraffin Reg3A Antibody
(3 Publications)
Species: Hu, Pm
Applications: IHC, IHC-P, WB
PAPOLA Antibody
NBP1-87345
Immunohistochemistry-Paraffin PAPOLA Antibody
Immunocytochemistry/ Immunofluorescence PAPOLA Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MRPS30 Antibody
NBP1-87343
Immunohistochemistry-Paraffin MRPS30 Antibody
Immunohistochemistry-Paraffin MRPS30 Antibody
Immunohistochemistry-Paraffin MRPS30 Antibody
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ASAP1 Antibody
NBP2-48909
Immunohistochemistry-Paraffin ASAP1 Antibody
Knockout Validated ASAP1 Antibody
Immunohistochemistry ASAP1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
Serpin F2/alpha
2-Antiplasmin Recombi ...
NBP1-90305PEP
Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP) (0)

There are no publications for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP) (0)

There are no reviews for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serpin F2/alpha 2-Antiplasmin Products

Research Areas for Serpin F2/alpha 2-Antiplasmin Protein (NBP1-90305PEP)

Find related products by research area.

Blogs on Serpin F2/alpha 2-Antiplasmin

There are no specific blogs for Serpin F2/alpha 2-Antiplasmin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Serpin E1/PAI-1 Antibody [NBP1-19773] - Extracts from Jurkat cells.
Serpin E1/PAI-1 Antibody - BSA Free
NBP1-19773

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Serpin F2/alpha 2-Antiplasmin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SERPINF2