SARS Nucleocapsid Protein Antibody (AP201054) [PE] Summary
Immunogen |
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1) |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
N |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Direct ELISA
- ELISA
- Immunoassay
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Reactivity Notes
Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Protein G purified |
Alternate Names for SARS Nucleocapsid Protein Antibody (AP201054) [PE]
Background
It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for SARS Nucleocapsid Protein Antibody (NBP2-90967PE) (0)
There are no publications for SARS Nucleocapsid Protein Antibody (NBP2-90967PE).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967PE) (0)
There are no reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967PE).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SARS Nucleocapsid Protein Antibody (NBP2-90967PE) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SARS Nucleocapsid Protein Products
Blogs on SARS Nucleocapsid Protein