Novus Biologicals products are now on bio-techne.com

SARS Nucleocapsid Protein Antibody (AP201054) [Alexa Fluor® 750]

Images

 
There are currently no images for SARS Nucleocapsid Protein Antibody (NBP2-90967AF750).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity V, VSpecies Glossary
Applications WB, ELISA, ICC/IF, ELISA
Clone
AP201054
Clonality
Monoclonal
Host
Mouse
Conjugate
Alexa Fluor 750

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

SARS Nucleocapsid Protein Antibody (AP201054) [Alexa Fluor® 750] Summary

Immunogen
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
N
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Direct ELISA
  • ELISA
  • Immunoassay
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Reactivity Notes

Use in SARS-CoV-2 reported in scientific literature (PMID:34944502) This antibody was selected for its ability to detect COVID-19 & SARS Coronavirus Nucleoprotein (NP) in direct ELISA. Immunogen displays the following percentage of sequence identity for non-tested species: COVID-19 (84%).

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein G purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for SARS Nucleocapsid Protein Antibody (AP201054) [Alexa Fluor® 750]

  • N protein
  • N structural protein
  • N
  • NC
  • Nucleocapsid protein
  • Nucleoprotein
  • Protein N
  • SARS coronavirus N protein
  • SARS coronavirus nucleocapsid protein
  • SARS CoV N protein
  • SARS CoV nucleocapsid protein
  • SARS CoV
  • SARS N protein
  • SARS Nucleoprotein
  • SARSCoV N protein
  • SARSCoV nucleocapsid protein
  • SARSCoV
  • Severe acute respiratory syndrome

Background

It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS Nucleocapsid Protein Antibody (NBP2-90967AF750) (0)

There are no publications for SARS Nucleocapsid Protein Antibody (NBP2-90967AF750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967AF750) (0)

There are no reviews for SARS Nucleocapsid Protein Antibody (NBP2-90967AF750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SARS Nucleocapsid Protein Antibody (NBP2-90967AF750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS Nucleocapsid Protein Antibody (AP201054) [Alexa Fluor® 750] and receive a gift card or discount.

Bioinformatics

Gene Symbol N