Novus Biologicals products are now on bio-techne.com

SARS-CoV-2 ORF7a Antibody - Azide and BSA Free

Images

 
There are currently no images for SARS-CoV-2 ORF7a Antibody (NBP3-07971).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity VSpecies Glossary
Applications ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

SARS-CoV-2 ORF7a Antibody - Azide and BSA Free Summary

Immunogen
Sequence: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORF7a
Purity
Antigen Affinity-purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:4000-1:8000
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.4, 50% glycerol.
Preservative
0.05% Proclin 300
Purity
Antigen Affinity-purified

Alternate Names for SARS-CoV-2 ORF7a Antibody - Azide and BSA Free

  • 2019-nCoV ORF7a Protein
  • 2019-nCoV ORF7a
  • Accessory Protein 7a
  • COVID-19 Accessory Protein 7a
  • COVID-19 ORF7a
  • COVID-19 Protein U122
  • COVID-19 Protein X4
  • Human coronavirus ORF7a Protein
  • ORF7a Protein
  • Protein U122
  • Protein X4
  • SARS-CoV-2 Accessory Protein 7a
  • SARS-CoV-2 Protein U122
  • SARS-CoV-2 Protein X4

Background

SARS-CoV-2 Open Reading Frame 7a (ORF7a) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF7a is a type I transmembrane protein with a 121 amino acid (aa) sequence and a theoretical molecular weight of 13.7 kDa (2, 3). ORF7a localizes mostly on the Golgi apparatus but also presents on the cell surface (4). The N-terminal domain of ORF7a is comprised of 7 beta-strands that form 2 beta-sheets, arranged by an immuno-globulin-like beta-sandwich fold (2, 5). The aa sequence alignment of SARS-CoV and SARS-CoV-2's ORF7a has 85.2% sequence identity and 95.9% sequence similarity (3).

Similar to its role in SARS-CoV, ORF7a of SARS-CoV-2 is an inhibitor of the host tetherin bone marrow stromal antigen-2 (BST-2) (2, 4). Functionally, ORF7a binds to BST-2, inhibiting its viral restriction activity by blocking glycosylation (2, 4).

References

1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-1

2. UniProt (P0DTC7)

3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4

4. Taylor, J. K., Coleman, C. M., Postel, S., Sisk, J. M., Bernbaum, J. G., Venkataraman, T., Sundberg, E. J., & Frieman, M. B. (2015). Severe Acute Respiratory Syndrome Coronavirus ORF7a Inhibits Bone Marrow Stromal Antigen 2 Virion Tethering through a Novel Mechanism of Glycosylation Interference. Journal of virology. https://doi.org/10.1128/JVI.02274-15

5. Nelson, C. A., Pekosz, A., Lee, C. A., Diamond, M. S., & Fremont, D. H. (2005). Structure and intracellular targeting of the SARS-coronavirus Orf7a accessory protein. Structure (London, England : 1993). https://doi.org/10.1016/j.str.2004.10.010

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS-CoV-2 ORF7a Antibody (NBP3-07971) (0)

There are no publications for SARS-CoV-2 ORF7a Antibody (NBP3-07971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SARS-CoV-2 ORF7a Antibody (NBP3-07971) (0)

There are no reviews for SARS-CoV-2 ORF7a Antibody (NBP3-07971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SARS-CoV-2 ORF7a Antibody (NBP3-07971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SARS-CoV-2 ORF7a Products

Array NBP3-07971

Blogs on SARS-CoV-2 ORF7a.

Early T cell response is associated with mild COVID-19 and rapid SARS-CoV-2 clearance
Jamshed Arslan, Pharm D, PhD SARS-CoV-2 induces both humoral and cellular immunity. A vaccine or natural infection invokes SARS-CoV-2-specific humoral components (antibodies from activated B cells) and cellular resp...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS-CoV-2 ORF7a Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ORF7a