Home » RPS15 » RPS15 Antibodies » RPS15 Antibody
Novus Biologicals products are now on bio-techne.com

RPS15 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RPS15 Antibody [NBP2-33717] - Analysis using Anti-RPS15 antibody NBP2-33717 (A) shows similar pattern to independent antibody NBP2-34083 (B).
Independent Antibodies: Western Blot: RPS15 Antibody [NBP2-33717] - Analysis using Anti-RPS15 antibody NBP2-33717 (A) shows similar pattern to independent antibody NBP2-34083 (B).
Immunocytochemistry/ Immunofluorescence: RPS15 Antibody [NBP2-33717] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human liver.
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human pancreas shows strong cytoplasmic and nucleolar positivity in exocrine glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human cerebral cortex, colon, liver and pancreas using Anti-RPS15 antibody NBP2-33717 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human colon.
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: RPS15 Antibody [NBP2-33717] - Staining of human pancreas.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

RPS15 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQH
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPS15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPS15 Protein (NBP2-33717PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPS15 Antibody

  • 40S ribosomal protein S15
  • homolog of rat insulinoma
  • MGC111130
  • ribosomal protein S15
  • RIG protein
  • RIGinsulinoma protein

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19P family of ribosomal proteins. It is located in the cytoplasm. This gene has been found to be activated in various tumors, such as insulinomas, esophageal cancers, and colon cancers. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
RPS18 Antibody -
Azide and BSA Free
NBP2-93632
Immunohistochemistry-Paraffin RPS18 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin RPS18 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin RPS18 Antibody - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RPS8 Antibody
(SR2540)
NBP3-27806
Western Blot RPS8 Antibody (SR2540)
Immunocytochemistry/ Immunofluorescence RPS8 Antibody (SR2540)
Western Blot RPS8 Antibody (SR2540)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
SUG1 Antibody
(25D5)
NB100-345
Knockdown Validated SUG1 Antibody (25D5)
Western Blot SUG1 Antibody (25D5)
Knockdown Validated SUG1 Antibody (25D5)
(2 Reviews)
(4 Publications)
Species: Hu
Applications: ChIP, IP, KD, WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RPS19 Antibody
NB100-2452
Western Blot RPS19 Antibody
Immunohistochemistry-Paraffin RPS19 Antibody
Immunohistochemistry-Paraffin RPS19 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
RPS16 Antibody
NBP1-80025
Immunohistochemistry-Paraffin RPS16 Antibody
Western Blot RPS16 Antibody
Western Blot RPS16 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
RPS4X Antibody
NBP3-21449
Immunohistochemistry-Paraffin RPS4X Antibody
Immunohistochemistry-Paraffin RPS4X Antibody
Immunohistochemistry-Paraffin RPS4X Antibody
Species: Hu
Applications: IHC-P
Recombinant Human
RPS4Y1 GST (N-Term) P ...
H00006192-P01
SDS-PAGE Recombinant Human RPS4Y1 GST (N-Term) Protein
(1 Review)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
RPS7 Antibody (3G4)
H00006201-M03
Western Blot RPS7 Antibody (3G4)
Immunocytochemistry/ Immunofluorescence RPS7 Antibody (3G4)
Immunohistochemistry-Paraffin RPS7 Antibody (3G4)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
PSMC1 Antibody
NBP1-80959
Immunohistochemistry-Paraffin PSMC1 Antibody
Immunohistochemistry-Paraffin PSMC1 Antibody
Immunohistochemistry-Paraffin PSMC1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RPS14 Antibody
NBP1-84847
Immunocytochemistry/ Immunofluorescence RPS14 Antibody
Immunohistochemistry-Paraffin RPS14 Antibody
Immunohistochemistry-Paraffin RPS14 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RPS11 Antibody
NBP2-22288
Western Blot RPS11 Antibody
Immunoprecipitation RPS11 Antibody
Immunohistochemistry-Paraffin RPS11 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
THRSP Antibody
NBP1-81290
Immunocytochemistry/ Immunofluorescence THRSP Antibody
Immunohistochemistry-Paraffin THRSP Antibody
Immunohistochemistry-Paraffin THRSP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
Proteasome 19S S7
Antibody
NBP1-87797
Western Blot Proteasome 19S S7 Antibody
Immunohistochemistry-Paraffin Proteasome 19S S7 Antibody
Simple Western Proteasome 19S S7 Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
PSMD8 Antibody
NBP1-83254
Immunocytochemistry/ Immunofluorescence PSMD8 Antibody
Immunohistochemistry-Paraffin PSMD8 Antibody
Immunohistochemistry-Paraffin PSMD8 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RPS10 Antibody -
BSA Free
NBP2-94502
Immunocytochemistry/ Immunofluorescence RPS10 Antibody - BSA Free
Immunohistochemistry-Paraffin RPS10 Antibody - BSA Free
Immunohistochemistry-Paraffin RPS10 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
RPS17 Antibody
(2C7)
H00006218-M01
Western Blot RPS17 Antibody (2C7)
Immunohistochemistry-Paraffin RPS17 Antibody (2C7)
Sandwich ELISA RPS17 Antibody (2C7)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
RPS9 Antibody
NBP2-88192
Immunohistochemistry-Paraffin RPS9 Antibody
Immunohistochemistry-Paraffin RPS9 Antibody
Western Blot RPS9 Antibody
Species: Hu
Applications: IHC, IHC-P, WB

Publications for RPS15 Antibody (NBP2-33717) (0)

There are no publications for RPS15 Antibody (NBP2-33717).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS15 Antibody (NBP2-33717) (0)

There are no reviews for RPS15 Antibody (NBP2-33717). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS15 Antibody (NBP2-33717) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS15 Products

Array NBP2-33717

Blogs on RPS15

There are no specific blogs for RPS15, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS15 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RPS15
Uniprot