Novus Biologicals products are now on bio-techne.com

RPL24/RLP24 Recombinant Protein Antigen

Name: RPL24/RLP24 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38992PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for RPL24/RLP24 Protein (NBP2-38992PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RPL24/RLP24 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RSL24D1. Source: E. coli Amino Acid Sequence: KCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	RSL24D1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38992. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RPL24/RLP24 Recombinant Protein Antigen

C15orf15
HRP-L30-iso
L30
RLP24
RPL24
RPL24L
RSL24D1 ribosomal L24 domain containing 1
TVAS3

Background

RPL24/RLP24 encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although RPL24/RLP24 has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes. [provided by RefSeq, Jul 2012]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RPL30 Antibody

NBP1-82855

Immunocytochemistry/ Immunofluorescence RPL30 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL29 Antibody

NBP3-12600

Immunohistochemistry-Paraffin RPL29 Antibody

Species: Hu

Applications: ICC/IF, IHC-P, IP, WB

RPL18 Antibody

NBP2-13251

Immunocytochemistry/ Immunofluorescence RPL18 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL5 Antibody

NBP1-31413

Immunohistochemistry-Paraffin RPL5 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

RPL6 Antibody

NBP2-20216

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

TEX10 Antibody

NBP3-09260

Species: Hu

Applications: WB

RPL11 Antibody

NBP2-20210

(1 Review)

Species: Hu, I, Mu, Ze

Applications: IHC-WhMt, IHC, IHC-P, WB

RPL14 Antibody

NBP1-85385

Immunohistochemistry-Paraffin RPL14 Antibody

Immunocytochemistry/ Immunofluorescence RPL14 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL15 Antibody

NBP2-20212

Species: Hu

Applications: IHC, IHC-P, WB

MED10 Antibody

NBP1-81328

Immunocytochemistry/ Immunofluorescence MED10 Antibody

Species: Hu

Applications: ICC/IF, WB

TM4SF1/L6 Antibody
(877621) [Unconjugate ...

MAB8164

Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]

(2 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, IHC

HN1L Antibody

NBP1-88446

Immunohistochemistry-Paraffin HN1L Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL32 Antibody
(HL2329) - Azide and ...

NBP3-25485

Western Blot RPL32 Antibody (HL2329) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence RPL32 Antibody (HL2329) - Azide and BSA Free

Species: Ca, Hu, Mu, Rt, Ze

Applications: ICC/IF, IHC, IHC-P, WB

RPL9 Antibody

NBP1-82853

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

RPL7 Antibody

NB100-2269

(1 Review)

(9 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, KD, WB

RPL27 Antibody -
Azide and BSA Free

NBP2-94240

Species: Hu, Mu, Rt

Applications: ICC/IF, WB

RPL19 Antibody
(3H4)

H00006143-M01

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt, Ye

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

PDLIM5 Antibody

NBP1-84843

Immunohistochemistry-Paraffin PDLIM5 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPS10 Antibody

NBP1-31357

Immunocytochemistry/ Immunofluorescence RPS10 Antibody

Immunohistochemistry-Paraffin RPS10 Antibody

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

RPL24/RLP24
Recombinant Protein A

NBP2-38992PEP

Species: Hu

Applications: AC

Publications for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

There are no publications for RPL24/RLP24 Protein (NBP2-38992PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

There are no reviews for RPL24/RLP24 Protein (NBP2-38992PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPL24/RLP24 Products

Research Areas for RPL24/RLP24 Protein (NBP2-38992PEP)

Find related products by research area.

Stem Cell Markers

Blogs on RPL24/RLP24

There are no specific blogs for RPL24/RLP24, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

RPL19 Antibody (3H4)
H00006143-M01

RPL7 Antibody
NB100-2269

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our RPL24/RLP24 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

RSL24D1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

RPL24/RLP24 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

RPL24/RLP24 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for RPL24/RLP24 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

Reviews for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

FAQs for RPL24/RLP24 Protein (NBP2-38992PEP) (0)

Additional RPL24/RLP24 Products

Research Areas for RPL24/RLP24 Protein (NBP2-38992PEP)

Blogs on RPL24/RLP24

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics