Home » RGS11 » RGS11 Proteins » RGS11 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RGS11 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RGS11 Recombinant Protein Antigen (NBP2-48745PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RGS11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RGS11.

Source: E. coli

Amino Acid Sequence: AQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RGS11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48745.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RGS11 Recombinant Protein Antigen

  • regulator of G-protein signaling 11
  • regulator of G-protein signalling 11
  • RS11

Background

RGS11 is encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal transducing G proteins. RGS11 has a G protein beta 5 subunit binding site. The RGS11 protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP bound form. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RGS7 Antibody
H00006000-B01P
Flow Cytometry RGS7 Antibody
Western Blot RGS7 Antibody
Western Blot RGS7 Antibody
Species: Hu, Rt
Applications: Flow, WB
GNB5 Antibody (3A3)
H00010681-M01
Proximity Ligation Assay GNB5 Antibody (3A3)
Western Blot GNB5 Antibody (3A3)
Sandwich ELISA GNB5 Antibody (3A3)
Species: Hu
Applications: ELISA, PLA, S-ELISA, WB
RGS9 Antibody
NBP1-58919
Western Blot RGS9 Antibody
Immunohistochemistry-Paraffin RGS9 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
RGS6 Antibody
NB100-56659
Western Blot RGS6 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
CD1c/BDCA-1
Antibody (OTI2F4)
NBP2-46123
Immunocytochemistry/ Immunofluorescence CD1c/BDCA-1 Antibody (OTI2F4)
Immunohistochemistry CD1c/BDCA-1 Antibody (OTI2F4)
Immunohistochemistry CD1c/BDCA-1 Antibody (OTI2F4)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SUCLG1 Antibody
NBP1-32728
Immunocytochemistry/ Immunofluorescence SUCLG1 Antibody
Immunohistochemistry-Paraffin SUCLG1 Antibody
Western Blot SUCLG1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
R9AP Antibody (D7)
NBP2-22470
R9AP Antibody (D7)
Species: Bv, Mu
Applications: ICC, IP, WB
mGluR6 Antibody
NB300-189
Immunocytochemistry/ Immunofluorescence mGluR6 Antibody
Western Blot mGluR6 Antibody
(6 Publications)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
SUCLG2 Antibody
NBP1-32521
Immunocytochemistry/ Immunofluorescence SUCLG2 Antibody
Western Blot SUCLG2 Antibody
Immunohistochemistry-Paraffin SUCLG2 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Pleckstrin Antibody
NB100-1343
Immunohistochemistry-Paraffin Pleckstrin Antibody
Immunohistochemistry-Paraffin Pleckstrin Antibody
Western Blot Pleckstrin Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
TRPM1 Antibody
NBP2-58415
Immunohistochemistry-Paraffin TRPM1 Antibody
Immunohistochemistry-Paraffin TRPM1 Antibody
Immunohistochemistry-Paraffin TRPM1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
RGS4 Antibody
(HL1522) - Azide and ...
NBP3-25636
Western Blot RGS4 Antibody (HL1522) - Azide and BSA Free
Western Blot RGS4 Antibody (HL1522) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence RGS4 Antibody (HL1522) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RGS3 Antibody
(1E8-C7)
H00005998-M01
Western Blot RGS3 Antibody (1E8-C7)
Immunocytochemistry/ Immunofluorescence RGS3 Antibody (1E8-C7)
Immunohistochemistry-Paraffin RGS3 Antibody (1E8-C7)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Kv11.1 Antibody -
Azide and BSA Free
NBP3-03109
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Western Blot Kv11.1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RGS11 Recombinant
Protein Antigen
NBP2-48745PEP
RGS11 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for RGS11 Recombinant Protein Antigen (NBP2-48745PEP) (0)

There are no publications for RGS11 Recombinant Protein Antigen (NBP2-48745PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS11 Recombinant Protein Antigen (NBP2-48745PEP) (0)

There are no reviews for RGS11 Recombinant Protein Antigen (NBP2-48745PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RGS11 Recombinant Protein Antigen (NBP2-48745PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RGS11 Products

Array NBP2-48745PEP

Research Areas for RGS11 Recombinant Protein Antigen (NBP2-48745PEP)

Find related products by research area.

Blogs on RGS11

There are no specific blogs for RGS11, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: SUCLG1 Antibody [NBP1-32728] - Sample: HeLa cells were fixed in 2% paraformaldehyde/culture medium at 37C for 30 min. Green: SUCLG1 protein stained by SUCLG1 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
SUCLG1 Antibody
NBP1-32728

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RGS11 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RGS11