RGM-A Antibody (2S1B4) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human RGM-A (Q96B86). TAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGRAAAGLPLAPRPLLGALVPLLALLPVFC |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
RGMA |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for RGM-A Antibody (2S1B4)
Background
The Repulsive Guidance Molecule A gene encodes a member of the repulsive guidance molecule family. The encoded protein is aglycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing andadult central nervous system. This protein may
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: Bind
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for RGM-A Antibody (NBP3-15314) (0)
There are no publications for RGM-A Antibody (NBP3-15314).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RGM-A Antibody (NBP3-15314) (0)
There are no reviews for RGM-A Antibody (NBP3-15314).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RGM-A Antibody (NBP3-15314) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RGM-A Products
Research Areas for RGM-A Antibody (NBP3-15314)
Find related products by research area.
|
Blogs on RGM-A