Home » RBBP6 » RBBP6 Proteins » Recombinant Human RBBP6 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human RBBP6 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human RBBP6 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-118 of Human RBBP6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
RBBP6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
39.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RBBP6 GST (N-Term) Protein

  • E3 ubiquitin-protein ligase RBBP6
  • EC 6.3.2.-
  • MY038
  • P2PR
  • P2P-R
  • p53-associated cellular protein of testis
  • PACTDKFZp761B2423
  • Proliferation potential-related protein
  • Protein P2P-R
  • RB-binding Q-protein 1
  • RBQ1
  • RBQ-1
  • retinoblastoma binding protein 6
  • Retinoblastoma-binding protein 6DKFZp686P0638
  • Retinoblastoma-binding Q protein 1
  • SNAMA

Background

The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western PKR Antibody (HL71/10) [Unconjugated]
Immunocytochemistry PKR Antibody (HL71/10) [Unconjugated]
Western Blot PKR Antibody (HL71/10) [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB
PKR Antibody - BSA
Free
NBP1-77266
Western Blot PKR Antibody - BSA Free
Western Blot PKR Antibody - BSA Free
Immunohistochemistry-Paraffin PKR Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PKLR Antibody
[Unconjugated]
AF8519
Western Blot PKLR Antibody [Unconjugated]
Simple Western PKLR Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TRBP Antibody
NBP2-24725
Western Blot TRBP Antibody
Immunohistochemistry-Paraffin TRBP Antibody
Immunohistochemistry-Paraffin TRBP Antibody
(1 Publication)
Species: Eq, Hu, Pm
Applications: IHC, IHC-P, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Dicer Antibody -
BSA Free
NBP1-71691
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunohistochemistry Dicer Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NCOA6 Antibody
NB200-335
Western Blot NCOA6 Antibody
Immunohistochemistry-Paraffin NCOA6 Antibody
Immunoprecipitation NCOA6 Antibody
(8 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
Applications: Secondary
Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
Immunocytochemistry/ Immunofluorescence Tenascin C Antibody (4C8MS) - BSA Free
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
(2 Reviews)
(26 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
RBM8A Antibody
NBP1-88376
Immunocytochemistry/ Immunofluorescence RBM8A Antibody
Western Blot RBM8A Antibody
Immunohistochemistry-Paraffin RBM8A Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
RAX Antibody
NB100-56467
Western Blot RAX Antibody
Species: Ca, Hu, Pm
Applications: WB
HSP90 alpha
Antibody
NB120-2928
Immunohistochemistry HSP90 alpha Antibody
Immunohistochemistry HSP90 alpha Antibody
Immunohistochemistry-Paraffin HSP90 alpha Antibody
(13 Publications)
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
RISC Antibody
NB100-56648
Western Blot RISC Antibody
Species: Hu, Mu, Rt
Applications: WB
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]
Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]
Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]
(1 Review)
(183 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
YB1 Antibody
NBP1-89945
Immunohistochemistry-Paraffin YB1 Antibody
Immunohistochemistry-Paraffin YB1 Antibody
Immunohistochemistry-Paraffin YB1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
EMP1 Antibody
NBP3-24816
Immunocytochemistry/ Immunofluorescence EMP1 Antibody
Species: Hu
Applications: ICC/IF

Publications for RBBP6 Recombinant Protein (H00005930-P01) (0)

There are no publications for RBBP6 Recombinant Protein (H00005930-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBBP6 Recombinant Protein (H00005930-P01) (0)

There are no reviews for RBBP6 Recombinant Protein (H00005930-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBBP6 Recombinant Protein (H00005930-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBBP6 Products

Research Areas for RBBP6 Recombinant Protein (H00005930-P01)

Find related products by research area.

Blogs on RBBP6

There are no specific blogs for RBBP6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
CXCL8/IL-8 Antibody (6217) [Unconjugated]
MAB208-100
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RBBP6 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol RBBP6