Novus Biologicals products are now on bio-techne.com

RASGRF1 Recombinant Protein Antigen

Images

 
There are currently no images for RASGRF1 Protein (NBP1-85727PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RASGRF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RASGRF1.

Source: E. coli

Amino Acid Sequence: RKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RASGRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85727.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RASGRF1 Recombinant Protein Antigen

  • CDC25guanine nucleotide exchange factor
  • CDC25L
  • GNRPguanine nucleotide-releasing factor 1
  • GRF1
  • GRF55
  • guanine nucleotide-releasing factor, 55 kD
  • Guanine nucleotide-releasing protein
  • H-GRF55
  • PP13187
  • Ras protein-specific guanine nucleotide-releasing factor 1
  • ras-GRF1
  • ras-specific guanine nucleotide-releasing factor 1
  • Ras-specific guanine nucleotide-releasing factor, CDC25 homolog
  • Ras-specific nucleotide exchange factor CDC25

Background

RASGRF1 is a critical step in signal transduction responses to stimulation of cell surface receptors by their ligands involves the accumulation of Ras proteins in their active GTP-bound state. To reach their active GTP-bound state, Ras proteins must first release bound GDP, a rate limiting step mediated by a guanine nucleotide releasing factor (GRF). The mammalian Ras p21 GRF protein has been designated Ras-GRF1 p140. Ras-GRF1 accelerates release of GDP from H- and N-Ras p21 protein in vitro, but not from the related Ral A or Cdc42Hs GTP-binding proteins. Of interest, a region mapping within the amino terminal domain of Ras-GRF1 is similar to both the human breakpoint cluster protein, Bcr, and the Dbl proto-oncogene product, a guanine nucleotide-releasing factor for Cdc42Hs. Ras-GRF2 p135 has also been identified. Ras-GRF2 p135 is highly homologous to Ras-GRF1 p140 except in the region between the REM and CDC25 domains and appears to function similarly to Ras-GRF1 p140.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
MAB37861
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3767
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-33506
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-81767
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-85727PEP
Species: Hu
Applications: AC

Publications for RASGRF1 Protein (NBP1-85727PEP) (0)

There are no publications for RASGRF1 Protein (NBP1-85727PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASGRF1 Protein (NBP1-85727PEP) (0)

There are no reviews for RASGRF1 Protein (NBP1-85727PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RASGRF1 Protein (NBP1-85727PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RASGRF1 Products

Array NBP1-85727PEP

Research Areas for RASGRF1 Protein (NBP1-85727PEP)

Find related products by research area.

Blogs on RASGRF1

There are no specific blogs for RASGRF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RASGRF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RASGRF1