![Western Blot: Rab5a Antibody [NBP1-58880] - Human Muscle.](http://images.novusbio.com/fullsize/Rab5a-Antibody-Western-Blot-NBP1-58880-img0003.jpg "Western Blot: Rab5a Antibody [NBP1-58880] - Human Muscle.")
| Reactivity | Hu, Mu, Ma, ZeSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to RAB5A(RAB5A, member RAS oncogene family). The peptide sequence was selected from the middle region of RAB5A. Peptide sequence KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS. The peptide sequence for this immunogen was taken from within the described region. |
| Marker | Early Endosome Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB5A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-58880 | Applications | Species |
|---|---|---|
| Pera M, Larrea D, Guardia-Laguarta C et al. Increased localization of APP-C99 in mitochondria-associated ER membranes causes mitochondrial dysfunction in Alzheimer disease. EMBO J. 2017-10-10 [PMID: 29018038] (WB, Mouse) | WB | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
NIKHIL VAD |
Immunofluorescence (IF) | Human | 07/17/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Rab5a Antibody (NBP1-58880)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| NIKHIL VAD 07/17/2018 |
||
| Application: | Immunofluorescence (IF) | |
| Species: | Human |
![Immunohistochemistry: Rab5a Antibody [NBP1-58880] - Zebra gut epithelial cells. Green: Primary antibody (1:5000). Red: actin (1:300). Blue: DAPI. Image submitted by Michel Bagnat, Duke University Medical Center. See customer feedback tab for detailed information.](http://images.novusbio.com/fullsize/Rab5a-Antibody-Immunohistochemistry-NBP1-58880-img0004.jpg "Immunohistochemistry: Rab5a Antibody [NBP1-58880] - Zebra gut epithelial cells. Green: Primary antibody (1:5000). Red: actin (1:300). Blue: DAPI. Image submitted by Michel Bagnat, Duke University Medical Center. See customer feedback tab for detailed information.")
![Immunohistochemistry: Rab5a Antibody [NBP1-58880] - Zebra gut epithelial cells. Green: Primary antibody (1:5000). Red: actin (1:300). Blue: DAPI. Image submitted by Michel Bagnat, Duke University Medical Center. See customer feedback tab for detailed information.](http://images.novusbio.com/fullsize/Rab5a-Antibody-Immunohistochemistry-NBP1-58880-img0005.jpg "Immunohistochemistry: Rab5a Antibody [NBP1-58880] - Zebra gut epithelial cells. Green: Primary antibody (1:5000). Red: actin (1:300). Blue: DAPI. Image submitted by Michel Bagnat, Duke University Medical Center. See customer feedback tab for detailed information.")
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
