Novus Biologicals products are now on bio-techne.com

PRRX2 Recombinant Protein Antigen

Name: PRRX2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-80893PEP
Price: 279 USD

Images

There are currently no images for PRRX2 Protein (NBP1-80893PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PRRX2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRRX2. Source: E. coli Amino Acid Sequence: RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PRRX2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80893. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRRX2 Recombinant Protein Antigen

paired related homeobox 2
paired-like homeodomain protein PRX2
Paired-related homeobox protein 2
PMX2paired mesoderm homeobox protein 2
PRX-2
PRX2MGC19843

Background

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PRRX1 Antibody

NBP1-06067

(8 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Peroxiredoxin 1
Antibody

NBP1-82558

(8 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Peroxiredoxin 2
Antibody (4E10-2D2)

H00007001-M01

Knockdown Validated Peroxiredoxin 2 Antibody (4E10-2D2)

Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)

(1 Review)

(6 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB

Peroxiredoxin 6
Antibody (3A10-2A11)

H00009588-M01

Western Blot Peroxiredoxin 6 Antibody (3A10-2A11)

(12 Publications)

Species: Bv, Hu

Applications: DB, ELISA, WB

Thioredoxin-1
Antibody - BSA Free

NBP2-52983

Immunocytochemistry/ Immunofluorescence Thioredoxin-1 Antibody - BSA Free

(1 Publication)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

SUG1 Antibody
(25D5)

NB100-345

(2 Reviews)

(4 Publications)

Species: Hu

Applications: ChIP, IP, KD, WB

RPS8 Antibody
(SR2540)

NBP3-27806

Immunocytochemistry/ Immunofluorescence RPS8 Antibody (SR2540)

Species: Ha, Hu, Mu, Rt

Applications: ICC/IF, IP, WB

Cdk5 Antibody

NBP2-15843

Immunohistochemistry-Paraffin Cdk5 Antibody

Immunocytochemistry/ Immunofluorescence Cdk5 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KO, WB

Peroxiredoxin 3
Antibody

NBP2-19777

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KO, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

Peroxiredoxin 5
Antibody [Unconjugate

AF5724

Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]

Species: Hu, Mu, Rt

Applications: ICC, WB

Nrf2 Antibody

NBP1-32822

(4 Reviews)

(71 Publications)

Species: Al, Av, Hu, Mu, Pl, Rt, Ze

Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

PAX9 Antibody (4B9)

H00005083-M03

Species: Hu, Rt

Applications: ELISA, KD, WB

Sonic Hedgehog/Shh
[Unconjugated]

464-SH

SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]

SEC-MALS Sonic Hedgehog/Shh [Unconjugated]

(69 Publications)

Species: Mu

Applications: BA

ERp57/PDIA3
Antibody

NBP1-84796

Immunohistochemistry-Paraffin ERp57/PDIA3 Antibody

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

Osterix/Sp7
Antibody (764704)

MAB7547

Immunocytochemistry Osterix/Sp7 Antibody (764704)

(1 Review)

(5 Publications)

Species: Hu

Applications: ICC, WB

Glutathione
Reductase Antibody

NBP2-16684

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Tenascin C
Antibody (4C8MS) - BS

NB110-68136

Immunocytochemistry/ Immunofluorescence Tenascin C Antibody (4C8MS) - BSA Free

(2 Reviews)

(26 Publications)

Species: Fe, Hu, Mu, Rt

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB

PRRX2 Recombinant
Protein Antigen

NBP1-80893PEP

Species: Hu

Applications: AC

Publications for PRRX2 Protein (NBP1-80893PEP) (0)

There are no publications for PRRX2 Protein (NBP1-80893PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRRX2 Protein (NBP1-80893PEP) (0)

There are no reviews for PRRX2 Protein (NBP1-80893PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRRX2 Protein (NBP1-80893PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRRX2 Products

Blogs on PRRX2

There are no specific blogs for PRRX2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Untreated (-) and treated (+) RAW264.7 whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.

Nrf2 Antibody
NBP1-32822

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our PRRX2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PRRX2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

PRRX2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

PRRX2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for PRRX2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PRRX2 Protein (NBP1-80893PEP) (0)

Reviews for PRRX2 Protein (NBP1-80893PEP) (0)

FAQs for PRRX2 Protein (NBP1-80893PEP) (0)

Additional PRRX2 Products

Blogs on PRRX2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics