Prokineticin 2 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Prokineticin 2. Peptide sequence: KSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRR The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PROK2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Prokineticin 2 Antibody
Background
Prokineticin 2 is known to regulate many different biological functions, including neurogenesis, smooth muscle contractility, angiogenesis and circadian rhythm. In serving the latter role, prokineticin 2 functions as an output molecule from the suprachiasmatic nucleus (SCN) of the hypothalamus, that transmits behavioral rhythms, but may also function locally within the SCN to synchronize output. Prokineticin 2 expression is induced by CLOCK and BMAL1 heterodimers and light, and is inhibited by period genes (PER1, PER2 and PER3) and cryptochrome genes (CRY1 and CRY2). Expression is reported in the SCN and among a few other discrete brain areas, including the islands of Calleja, media l preoptic area of the hypothalamus and the shell of the nucleus accumbens as well as in the testis, prostate and, at lower levels, in the small intestine.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Gt, Hu, Po
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Publications for Prokineticin 2 Antibody (NBP2-86756) (0)
There are no publications for Prokineticin 2 Antibody (NBP2-86756).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Prokineticin 2 Antibody (NBP2-86756) (0)
There are no reviews for Prokineticin 2 Antibody (NBP2-86756).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Prokineticin 2 Antibody (NBP2-86756) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Prokineticin 2 Products
Research Areas for Prokineticin 2 Antibody (NBP2-86756)
Find related products by research area.
|
Blogs on Prokineticin 2