Procalcitonin Antibody

Images

 
Western Blot: Procalcitonin Antibody [NBP3-16983] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: Procalcitonin Antibody [NBP3-16983] - Analysis in human thyroid gland and duodenum tissues using Anti-CALCA antibody. Corresponding CALCA RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Procalcitonin Antibody [NBP3-16983] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: Procalcitonin Antibody [NBP3-16983] - Staining of human thyroid gland shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Procalcitonin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALCA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Procalcitonin Antibody

  • CALC1
  • CALCA
  • Calcitonin 1
  • calcitonin gene-related peptide 1
  • CGRP
  • Katacalcin
  • Procalcitonin

Background

Procalcitonin (PCT) is a 116 amino acid residue peptide with molecular weight of about 13 kDa. PCT itself has no known hormonal activity. PCT belongs to a group of related proteins including calcitonin gene-related peptides I and II, amylin, adrenomodulin and calcitonin (CAPA peptide family). PCT, like other peptides of CAPA family, appears from the common precursor pre-procalcitonin consisting of 141 amino acids by removal of 25 amino acids from the N-terminus. PCT undergoes successive cleavages to form three molecules: N-terminal fragment (55 a.a.), calcitonin (32 a.a.) and katacalcin (21 a.a.). Under normal metabolic conditions, PCT is only present in the C cells of the thyroid gland. In bacterial infection and sepsis, however, intact PCT is found in the blood and, more importantly, its level is related to the severity of bacterial sepsis. Today, PCT is considered to be one of the earliest and most specific markers of sepsis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Procalcitonin Antibody (NBP3-16983) (0)

There are no publications for Procalcitonin Antibody (NBP3-16983).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Procalcitonin Antibody (NBP3-16983) (0)

There are no reviews for Procalcitonin Antibody (NBP3-16983). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Procalcitonin Antibody (NBP3-16983) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Procalcitonin Products

Research Areas for Procalcitonin Antibody (NBP3-16983)

Find related products by research area.

Blogs on Procalcitonin

There are no specific blogs for Procalcitonin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Procalcitonin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCA