Novus Biologicals products are now on bio-techne.com

Pinin Recombinant Protein Antigen

Name: Pinin Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-87784PEP
Price: 279 USD

Images

There are currently no images for Pinin Protein (NBP1-87784PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Pinin Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PNN. Source: E. coli Amino Acid Sequence: EQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEEEKEIAIVHSDAEKE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PNN
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87784. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pinin Recombinant Protein Antigen

140 kDa nuclear and cell adhesion-related phosphoprotein
Desmosome-associated protein
Domain-rich serine protein
DRS protein
DRSP
DRSSR-like protein
Melanoma metastasis clone A protein
memA
neutrophil protein
Nuclear protein SDK3
pinin
pinin, desmosome associated protein
SDK3

Background

PNN is a nuclear and cell adhesion-related protein involved in cell adhesion, mRNA processing, and transcriptional regulation. PNN functions as a transcriptional regulator by relieving CtBP1-mediated repression of the E-cadherin gene. In the role of mRNA processing, PNN functions as a splicing regulator. The role of PNN in transcription and mRNA processing suggests the role of PNN as a coupling factor for the two processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]

664-LI

Bioactivity LIGHT/TNFSF14 [Unconjugated]

(21 Publications)

Species: Hu

Applications: BA

DNER Antibody
[Unconjugated]

AF2254

Immunocytochemistry/ Immunofluorescence DNER Antibody [Unconjugated]

(12 Publications)

Species: Mu

Applications: IHC, WB

ZNF198 Antibody

NBP1-84685

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

gamma-Synuclein
Antibody

NBP1-89996

Immunohistochemistry-Paraffin gamma-Synuclein Antibody

Immunohistochemistry gamma-Synuclein Antibody

Species: Hu

Applications: IHC, IHC-P, WB

Secretin R Antibody

NBP1-86125

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

Myoglobin Antibody
[Unconjugated]

G-125-C

Species: Hu

Applications: Secondary

RNPS1 Antibody
(7G8)

H00010921-M05

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, IP, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

SHBG [HRP]

DSHBG0B

(9 Publications)

Species: Hu

Applications: ELISA

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

Myeloperoxidase/MPO An ...

AF3667

Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]

Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]

(3 Reviews)

(167 Publications)

Species: Hu, Mu

Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB

GCLC Antibody (3H1)

H00002729-M01

Immunocytochemistry/ Immunofluorescence GCLC Antibody (3H1)

(17 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

UGCG Antibody (1E5)

H00007357-M03

(1 Review)

(4 Publications)

Species: Hu

Applications: ELISA, WB

DBT Antibody

NBP1-89522

Immunohistochemistry-Paraffin DBT Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Mineralocorticoid
R/NR3C2 Antibody (H10 ...

NB300-562

Western Blot Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free

Immunocytochemistry/ Immunofluorescence Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free

(2 Publications)

Species: Ch, Hu, Mu, Rb, Rt, Sh

Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB

Calmodulin 2
Antibody

NBP2-14871

(1 Publication)

Species: Mu, Rt

Applications: ICC/IF, WB

Calmodulin
Antibody (2D1) - BSA

NB120-2860

(3 Publications)

Species: Ba, Bv, Ch, Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Calmodulin 3
Antibody

NBP2-15669

Immunohistochemistry Whole-Mount Calmodulin 3 Antibody

(1 Publication)

Species: Mu, Rt, Ze

Applications: IHC-WhMt, IHC, WB

KRIT1 Antibody

NBP2-47405

Species: Hu

Applications: IHC, IHC-P

Pinin Recombinant
Protein Antigen

NBP1-87784PEP

Species: Hu

Applications: AC

Publications for Pinin Protein (NBP1-87784PEP) (0)

There are no publications for Pinin Protein (NBP1-87784PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pinin Protein (NBP1-87784PEP) (0)

There are no reviews for Pinin Protein (NBP1-87784PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pinin Protein (NBP1-87784PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pinin Products

Blogs on Pinin

There are no specific blogs for Pinin, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Western blot shows lysates of HL-60 human acute promyelocytic leukemia cell line, human neutrophil cells, and mouse spleen tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF019). A specific band was detected for Myeloperoxidase/MPO at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.

Myeloperoxidase/MPO Antibody [Unconjugated]
AF3667

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Pinin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PNN

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Pinin Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Pinin Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Pinin Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Pinin Protein (NBP1-87784PEP) (0)

Reviews for Pinin Protein (NBP1-87784PEP) (0)

FAQs for Pinin Protein (NBP1-87784PEP) (0)

Additional Pinin Products

Blogs on Pinin

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics