![Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug] - Detection against Immunogen (31.13 KDa) .](http://images.novusbio.com/fullsize/PIGW-Antibody-1D8-Western-Blot-H00284098-M05-100ug-img0003.jpg "Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug] - Detection against Immunogen (31.13 KDa) .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 1D8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PIGW (NP_848612.2, 399 a.a. ~ 447 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PIGW |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PIGW |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug] - Analysis of PIGW expression in MCF-7.](http://images.novusbio.com/fullsize/PIGW-Antibody-1D8-Western-Blot-H00284098-M05-100ug-img0002.jpg "Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug] - Analysis of PIGW expression in MCF-7.")
![ELISA: PIGW Antibody (1D8) [H00284098-M05-100ug] - Detection limit for recombinant GST tagged PIGW is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PIGW-Antibody-1D8-ELISA-H00284098-M05-100ug-img0001.jpg "ELISA: PIGW Antibody (1D8) [H00284098-M05-100ug] - Detection limit for recombinant GST tagged PIGW is 0.3 ng/ml as a capture antibody.")
