Novus Biologicals products are now on bio-techne.com

PEX13 Recombinant Protein Antigen

Name: PEX13 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-86321PEP
Price: 289 USD

Images

There are currently no images for PEX13 Protein (NBP1-86321PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

PEX13 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEX13. Source: E. coli Amino Acid Sequence: SADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PEX13
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86321. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PEX13 Recombinant Protein Antigen

NALD
peroxin-13
peroxisomal biogenesis factor 13
peroxisomal membrane protein PEX13
peroxisome biogenesis factor 13
ZWS

Background

PEX13 is a component of the peroxisomal translocation machinery with PEX14 and PEX17. It functions as a docking factor for the predominantly cytoplasmnic PTS1 receptor. It is also involved in the import of PTS1 and PTS2 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PEX14 Antibody

NBP2-33455

Species: Hu

Applications: ICC/IF, IHC, IHC-P

PEX7 Antibody

NBP1-57578

(1 Publication)

Species: Hu

Applications: WB

PEX5 Antibody

NBP1-87185

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

ABCD1 Antibody
(OTI2C12)

NBP2-46476

Immunohistochemistry ABCD1 Antibody (OTI2C12)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, KD, KO, WB

PHEX

8090-ZN

Species: Hu

Applications: EnzAct

PEX12 Antibody

NBP2-49599

Immunohistochemistry-Paraffin PEX12 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

PXMP3 Antibody -
Azide and BSA Free

NBP2-94643

Immunohistochemistry-Paraffin PXMP3 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

PEX19 Antibody

NBP1-32925

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

PEX10 Antibody -
BSA Free

NBP3-18137

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, WB

PEX1 Antibody

NBP1-80577

Immunocytochemistry/ Immunofluorescence PEX1 Antibody

(3 Publications)

Species: Hu

Applications: ICC/IF, WB

ZNF260 Antibody

NBP1-80967

Immunocytochemistry/ Immunofluorescence ZNF260 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Src [p Tyr419]
Antibody [Unconjugate

AF2685

Simple Western Src [p Tyr419] Antibody [Unconjugated]

Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]

(1 Review)

(10 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

PEX6 Antibody

NBP1-80955

Immunohistochemistry-Paraffin PEX6 Antibody

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

PEX3 Antibody -
BSA Free

NBP3-18138

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, WB

PTS Antibody

NBP1-32975

Immunocytochemistry/ Immunofluorescence PTS Antibody

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KO, WB

Holo-Transferrin
[Unconjugated]

2914-HT

(51 Publications)

Species: Hu

Applications: BA

Recombinant Human
PEX11A GST (N-Term) P ...

H00008800-P01

Species: Hu

Applications: ELISA, AP, PA, WB

Publications for PEX13 Protein (NBP1-86321PEP) (0)

There are no publications for PEX13 Protein (NBP1-86321PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX13 Protein (NBP1-86321PEP) (0)

There are no reviews for PEX13 Protein (NBP1-86321PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PEX13 Protein (NBP1-86321PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX13 Products

Blogs on PEX13

There are no specific blogs for PEX13, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.

Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our PEX13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PEX13

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

PEX13 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

PEX13 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for PEX13 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PEX13 Protein (NBP1-86321PEP) (0)

Reviews for PEX13 Protein (NBP1-86321PEP) (0)

FAQs for PEX13 Protein (NBP1-86321PEP) (0)

Additional PEX13 Products

Blogs on PEX13

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics