Home » PDE11A » PDE11A Proteins » PDE11A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PDE11A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PDE11A Protein (NBP1-85919PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PDE11A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDE11A.

Source: E. coli

Amino Acid Sequence: VVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDE11A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85919.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDE11A Recombinant Protein Antigen

  • cAMP and cGMP cyclic nucleotide phosphodiesterase 11A
  • cAMP and cGMP phosphodiesterase 11A
  • cyclic nucleotide phosphodiesterase 11A
  • dual 3'-5'-cyclic-AMP and -GMP phosphodiesterase 11A
  • EC 3.1.4
  • EC 3.1.4.17
  • EC 3.1.4.35
  • EC 3.1.4.53
  • FLJ23693
  • MGC133355
  • MGC133356
  • PDE11A
  • PDE11A1
  • PDE11A2
  • PDE11A3
  • phosphodiesterase 11A
  • PPNAD2

Background

The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates and provide a mechanism to downregulate cAMP and cGMP signaling. This gene encodes a member of the PDE protein superfamily. Mutations in this gene are a cause of Cushing disease and adrenocortical hyperplasia. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ALDH7A1 Antibody
NBP2-15343
Immunocytochemistry/ Immunofluorescence ALDH7A1 Antibody
Western Blot ALDH7A1 Antibody
Immunohistochemistry-Paraffin ALDH7A1 Antibody
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Protein Kinase A
regulatory subunit I ...
NBP1-47935
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Western Blot Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
Immunohistochemistry-Paraffin Protein Kinase A regulatory subunit I alpha Antibody (OTI6C7)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PDE5A Antibody
NBP1-86139
Immunohistochemistry-Paraffin PDE5A Antibody
Immunohistochemistry-Paraffin PDE5A Antibody
Immunohistochemistry-Paraffin PDE5A Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PDE8B Antibody
NB300-644
Unknown PDE8B Antibody
Western Blot PDE8B Antibody
Species: Bv, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
PDE3B Antibody
NBP3-12242
Immunohistochemistry-Paraffin PDE3B Antibody
Western Blot PDE3B Antibody
Western Blot PDE3B Antibody
Species: Ch, Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
G protein alpha
Antibody (2A2B7) - BS ...
NBP2-52477
ELISA G protein alpha Antibody (2A2B7) - BSA Free
Flow Cytometry G protein alpha Antibody (2A2B7) - BSA Free
Immunohistochemistry G protein alpha Antibody (2A2B7) - BSA Free
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
PDE10A Antibody
NB300-645
Immunohistochemistry-Paraffin PDE10A Antibody
Western Blot PDE10A Antibody
Western Blot PDE10A Antibody
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
PDE1A Antibody
(OTI7D5)
NBP2-46355
Immunohistochemistry PDE1A Antibody (OTI7D5)
Immunohistochemistry PDE1A Antibody (OTI7D5)
Immunohistochemistry PDE1A Antibody (OTI7D5)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Phosphodiesterase
4A/PDE4A Antibody (OT ...
NBP2-02559
Flow Cytometry Phosphodiesterase 4A/PDE4A Antibody (OTI1C8)
Immunocytochemistry/ Immunofluorescence Phosphodiesterase 4A/PDE4A Antibody (OTI1C8)
Immunohistochemistry-Paraffin Phosphodiesterase 4A/PDE4A Antibody (OTI1C8)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
FGF-9
[Unconjugated]
273-F9
Bioactivity FGF-9 [Unconjugated]
(47 Publications)
Species: Hu
Applications: BA
PDE2A Antibody
(OTI3A4)
NBP2-03598
Flow Cytometry PDE2A Antibody (OTI3A4)
Flow Cytometry PDE2A Antibody (OTI3A4)
Western Blot PDE2A Antibody (OTI3A4)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PDE4B Antibody
(OTI1D12)
NBP2-01171
Flow Cytometry PDE4B Antibody (OTI1D12)
Flow Cytometry PDE4B Antibody (OTI1D12)
Western Blot PDE4B Antibody (OTI1D12)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SPRY4 Antibody
[Unconjugated]
AF5070
Western Blot SPRY4 Antibody [Unconjugated]
Simple Western SPRY4 Antibody [Unconjugated]
Western Blot SPRY4 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: Simple Western, WB
PDE9A Antibody -
BSA Free
NBP1-00641
Western Blot PDE9A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PDE9A Antibody - BSA Free
Immunohistochemistry PDE9A Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
IGF-II/IGF2
[Unconjugated]
292-G2
SDS-PAGE IGF-II/IGF2 [Unconjugated]
Bioactivity IGF-II/IGF2 [Unconjugated]
(48 Publications)
Species: Hu
Applications: BA

Publications for PDE11A Protein (NBP1-85919PEP) (0)

There are no publications for PDE11A Protein (NBP1-85919PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE11A Protein (NBP1-85919PEP) (0)

There are no reviews for PDE11A Protein (NBP1-85919PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PDE11A Protein (NBP1-85919PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDE11A Products

Research Areas for PDE11A Protein (NBP1-85919PEP)

Find related products by research area.

Blogs on PDE11A

There are no specific blogs for PDE11A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PDE11A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PDE11A