I need a proven anti-human Ptch1 antibody that maps C-terminus of Ptch1 protein which is thus appropriate for all isoforms of human Ptch1 protein. Can you please suggest any which can be used for Western blotting?

Name: Recombinant Human Patched 1/PTCH GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00005727-Q01
Price: 569 USD

Question

Accepted Answer

NB100-41101 is expected to recognize all isoforms. NBP2-19705, NBP1-71662, 21130002, and NBP1-59455 should all suit your needs as well. Further details about each product can be found on their individual datasheets.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 841-940 of Human Patched 1/PTCH Source: Wheat Germ (in vitro) Amino Acid Sequence: PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	PTCH1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Recombinant Human Patched 1/PTCH GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human Patched 1/PTCH GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human Patched 1/PTCH GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Patched 1/PTCH Partial Recombinant Protein (H00005727-Q01) (0)

Reviews for Patched 1/PTCH Partial Recombinant Protein (H00005727-Q01) (0)

Product General Protocols

Video Protocols

FAQs for Patched 1/PTCH Partial Recombinant Protein (H00005727-Q01). (Showing 1 - 1 of 1 FAQ).

Additional Patched 1/PTCH Products

Research Areas for Patched 1/PTCH Partial Recombinant Protein (H00005727-Q01)

Blogs on Patched 1/PTCH

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics