Home » p107 » p107 Proteins » p107 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

p107 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for p107 Protein (NBP2-33791PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

p107 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBL1.

Source: E. coli

Amino Acid Sequence: DAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFEKKRSFAPSTPLTGRRYLRE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33791.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p107 Recombinant Protein Antigen

  • cellular protein 107,107 kDa retinoblastoma-associated protein
  • cp107
  • p107MGC40006
  • PRB1
  • retinoblastoma-like 1 (p107)
  • retinoblastoma-like protein 1

Background

p107, also known as Retinoblastoma-like protein 1, consists of a 121 kDa 1068 and 115 kDa 1014 isoform. The primary function of p107 is to encode a gene that plays a crutial role in regulating entry into cell division. Current research on p107 is being conducted in relation to carcinoma, cholangiocarcinoma, osteosarcoma, lung cancer, prostate cancer, breast cancer, endometrial cancer, glioblastoma, burkitt's lymphoma, myeloid leukemia and cervicitis. p107 is linked to the cell cycle, transcription, s phase, senescence and DNA replication pathways where it interacts with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p130 Antibody
NBP1-82455
Immunohistochemistry-Paraffin p130 Antibody
Immunohistochemistry-Paraffin p130 Antibody
Immunohistochemistry-Paraffin p130 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
NOLC1 Antibody
NBP3-38210
Immunocytochemistry/ Immunofluorescence NOLC1 Antibody
Western Blot NOLC1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RAB3GAP1 Antibody
NBP2-38206
Western Blot RAB3GAP1 Antibody
Immunohistochemistry-Paraffin RAB3GAP1 Antibody
Species: Hu
Applications: IHC, IHC-P, KD, WB
Retinoblastoma
binding protein 1 Ant ...
NBP1-26616
Western Blot Retinoblastoma binding protein 1 Antibody
Immunoprecipitation Retinoblastoma binding protein 1 Antibody
Species: Hu
Applications: IP, WB
CDK2 Antibody
(OTI2D9)
NBP2-00776
Flow Cytometry CDK2 Antibody (OTI2D9)
Flow Cytometry CDK2 Antibody (OTI2D9)
Flow Cytometry CDK2 Antibody (OTI2D9)
(1 Review)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
E2F-4 Antibody
NBP1-21374
Immunoprecipitation E2F-4 Antibody
Knockdown Validated E2F-4 Antibody
Immunohistochemistry-Paraffin E2F-4 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
E2F-1 Antibody
(JJ092-02)
NBP2-67899
Flow Cytometry E2F-1 Antibody (JJ092-02)
Immunocytochemistry/ Immunofluorescence E2F-1 Antibody (JJ092-02)
Immunocytochemistry/ Immunofluorescence E2F-1 Antibody (JJ092-02)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CDK4 Antibody
NBP1-31308
Immunocytochemistry/ Immunofluorescence CDK4 Antibody
Immunocytochemistry/ Immunofluorescence CDK4 Antibody
Immunohistochemistry-Paraffin CDK4 Antibody
(7 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
Western Blot D4S234E Antibody (1C3)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
26S proteasome
subunit 9 Antibody
NBP2-47560
Immunohistochemistry 26S proteasome subunit 9 Antibody
Immunohistochemistry-Paraffin 26S proteasome subunit 9 Antibody
Immunohistochemistry-Paraffin 26S proteasome subunit 9 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TMED7 Antibody
NBP1-90949
Immunohistochemistry TMED7 Antibody
Immunohistochemistry TMED7 Antibody
Immunohistochemistry TMED7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Dynactin 6 Antibody
NBP1-80616
Immunohistochemistry-Paraffin Dynactin 6 Antibody
Western Blot Dynactin 6 Antibody
Western Blot Dynactin 6 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SSSCA1 Antibody
(OTI2F5)
NBP2-03198
Flow Cytometry SSSCA1 Antibody (OTI2F5)
Flow Cytometry SSSCA1 Antibody (OTI2F5)
Flow Cytometry SSSCA1 Antibody (OTI2F5)
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p107 Recombinant
Protein Antigen
NBP2-33791PEP
p107 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for p107 Protein (NBP2-33791PEP) (0)

There are no publications for p107 Protein (NBP2-33791PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p107 Protein (NBP2-33791PEP) (0)

There are no reviews for p107 Protein (NBP2-33791PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p107 Protein (NBP2-33791PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p107 Products

Research Areas for p107 Protein (NBP2-33791PEP)

Find related products by research area.

Blogs on p107

There are no specific blogs for p107, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p107 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RBL1