![Western Blot: OASL2 Antibody [NBP3-10127] - Western blot analysis of OASL2 in Rat Brain lysates. Antibody dilution at 1ug/ml](http://images.novusbio.com/fullsize/OASL2-Antibody-Western-Blot-NBP3-10127-img0001.jpg "Western Blot: OASL2 Antibody [NBP3-10127] - Western blot analysis of OASL2 in Rat Brain lysates. Antibody dilution at 1ug/ml")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of rat OASL2 (NP_035984.2). Peptide sequence VRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTT |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | Oasl2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 59 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Caylee Silvers |
WB | Mouse | 06/07/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | Oasl2 |
![Western Blot: OASL2 Antibody [NBP3-10127] - Western blot on murine lysate. 20 ug protein; block: 5% BSA; 1:500 primary antibody dilution. Image from verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp3-10127_rabbit-polyclonal-oasl2-antibody-western-blot-206202316432..jpg "Western Blot: OASL2 Antibody [NBP3-10127] - Western blot on murine lysate. 20 ug protein; block: 5% BSA; 1:500 primary antibody dilution. Image from verified customer review.")
![Immunocytochemistry OAS2 Antibody (HLS56/3) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1925_human-oas2-mab-clone-hls56-3-immunocytochemistry-7122021154020.jpg)
![Immunocytochemistry MxA/Mx1 Antibody [Unconjugated]](https://images.novusbio.com/images2/MxA_AF7946_Immunocytochemistry__Immunofluorescence_23352.jpg)
![Western Blot MxA/Mx1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Mx1_AF7946_Western_Blot_13003.jpg)
![Immunohistochemistry MxA/Mx1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Mx1_AF7946_Immunohistochemistry_13014.jpg)
![ISG15/UCRP [7-Amino-4-Methyl Coumarin]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ISG15/UCRP [7-Amino-4-Methyl Coumarin]")
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")