Novus Biologicals products are now on bio-techne.com

NUDT15 Recombinant Protein Antigen

Name: NUDT15 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38436PEP
Price: 279 USD

Images

There are currently no images for NUDT15 Protein (NBP2-38436PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NUDT15 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NUDT15. Source: E. coli Amino Acid Sequence: EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	NUDT15
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38436. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NUDT15 Recombinant Protein Antigen

8-oxo-dGTPase NUDT15
A730068G11Rik
EC 3.1.6.-
FLJ10956
MTH2MGC104352
MutT homolog 2
Nucleoside diphosphate-linked moiety X motif 15
nudix (nucleoside diphosphate linked moiety X)-type motif 15
Nudix motif 15
nudix-type motif 15
probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15
RP11-90M2.1

Background

NUDT15 mediates the hydrolysis of some nucleoside diphosphate derivatives. Can degrade 8-oxo-dGTP in vitro, suggesting that it may remove an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool, thereby preventin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MTH1 Antibody -
BSA Free

NB100-109

Knockout Validated MTH1 Antibody - BSA Free

(36 Publications)

Species: Hu, Mu, Rt

Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, Single-Cell Western, WB

NUDT18 Antibody
(OTI5D7)

NBP2-01432

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

PCNA Antibody
(PC10)

NB500-106

(5 Reviews)

(46 Publications)

Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze

Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

RCBTB2 Antibody

NBP1-36981

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA, WB

LPAR6/P2RY5
Antibody - BSA Free

NLS850

Species: Hu

Applications: IHC, IHC-P

Plastin L Antibody

NBP2-19860

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Endostatin [HRP]

DNST0

(22 Publications)

Species: Hu

Applications: ELISA

Carbonic Anhydrase
III/CA3 Antibody (4A1 ...

H00000761-M02

Immunohistochemistry-Paraffin Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

Sandwich ELISA Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

(5 Publications)

Species: Hu, Mu

Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB

TINAGL1 Antibody
(812417)

MAB7185

Species: Hu

Applications: Simple Western, WB

Carbonic Anhydrase
I/CA1 Antibody

NBP1-88191

Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody

(3 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

OXSM Antibody

NBP1-84732

Immunohistochemistry-Paraffin OXSM Antibody

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

ITM2B Antibody

NBP1-36963

Immunocytochemistry/ Immunofluorescence ITM2B Antibody

(1 Publication)

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

ESD Antibody

NBP2-16374

Species: Hu, Mu, Rt, Ze

Applications: ICC/IF, IHC, IHC-P, WB

MED4 Antibody

NBP1-84977

(1 Publication)

Species: Hu, Pm

Applications: ICC/IF, IHC, IHC-P, WB

Arginase
1/ARG1/liver Arginase ...

NBP1-32731

Immunohistochemistry-Paraffin Arginase 1/ARG1/liver Arginase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Arginase 1/ARG1/liver Arginase Antibody - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB

SLC25A30 Antibody

NBP3-10573

Species: Hu

Applications: WB

TOX4 Antibody

NBP1-88433

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ADP-Sugar
Pyrophosphatase/NUDT5 ...

NBP1-83131

Immunohistochemistry ADP-Sugar Pyrophosphatase/NUDT5 Antibody

Immunohistochemistry-Paraffin ADP-Sugar Pyrophosphatase/NUDT5 Antibody

Species: Hu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Publications for NUDT15 Protein (NBP2-38436PEP) (0)

There are no publications for NUDT15 Protein (NBP2-38436PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT15 Protein (NBP2-38436PEP) (0)

There are no reviews for NUDT15 Protein (NBP2-38436PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NUDT15 Protein (NBP2-38436PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NUDT15 Products

Blogs on NUDT15

There are no specific blogs for NUDT15, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

PCNA Antibody (PC10)
NB500-106

Flow Cytometry: Arginase 1/ARG1/liver Arginase Antibody [NBP1-32731] - An intracellular stain was performed on HepG2 with NBP1-32731 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.

Arginase 1/ARG1/liver Arginase Antibody - BSA Free
NBP1-32731

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our NUDT15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

NUDT15

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

NUDT15 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

NUDT15 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for NUDT15 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for NUDT15 Protein (NBP2-38436PEP) (0)

Reviews for NUDT15 Protein (NBP2-38436PEP) (0)

FAQs for NUDT15 Protein (NBP2-38436PEP) (0)

Additional NUDT15 Products

Blogs on NUDT15

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics