![Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human kidney shows no positivity in cells in tubules or glomeruli as expected.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-Paraffin-NBP2-46648-img0012.jpg "Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human kidney shows no positivity in cells in tubules or glomeruli as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clone | CL3063 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI |
| Epitope | HTKYSKYKFTPAAEF |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NET1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: NET1 Antibody (CL3063) [NBP2-46648] - Staining of rat pons shows strong positivity in noradarenaine neurons in the locus coeruleus.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-NBP2-46648-img0013.jpg "Immunohistochemistry: NET1 Antibody (CL3063) [NBP2-46648] - Staining of rat pons shows strong positivity in noradarenaine neurons in the locus coeruleus.")
![Immunohistochemistry: NET1 Antibody (CL3063) [NBP2-46648] - Staining of rat cerebellum shows strong positivity in noradrenergic fibers.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-NBP2-46648-img0014.jpg "Immunohistochemistry: NET1 Antibody (CL3063) [NBP2-46648] - Staining of rat cerebellum shows strong positivity in noradrenergic fibers.")
![Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human placenta shows weak membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-Paraffin-NBP2-46648-img0015.jpg "Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human placenta shows weak membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human placenta shows weak membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-Paraffin-NBP2-46648-img0016.jpg "Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human placenta shows weak membranous positivity in trophoblastic cells.")
![Immunohistochemistry: NET1 Antibody (CL3063) [NBP2-46648] - Staining of mouse brain shows strong positivity in noradrenergic fibers in the cerebral cortex.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-Paraffin-NBP2-46648-img0008.jpg "Immunohistochemistry: NET1 Antibody (CL3063) [NBP2-46648] - Staining of mouse brain shows strong positivity in noradrenergic fibers in the cerebral cortex.")
![Immunohistochemistry: NET1 Antibody (CL3063) [NBP2-46648] - Staining of mouse brain shows strong positivity in noradrenergic fibers in the hippocampus.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-Paraffin-NBP2-46648-img0009.jpg "Immunohistochemistry: NET1 Antibody (CL3063) [NBP2-46648] - Staining of mouse brain shows strong positivity in noradrenergic fibers in the hippocampus.")
![Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human locus coeruleus shows strong cytoplasmic positivity in noradrenaline neurons.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-Paraffin-NBP2-46648-img0010.jpg "Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human locus coeruleus shows strong cytoplasmic positivity in noradrenaline neurons.")
![Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human prostate shows strong positivity in sympathetic peripheral nerves.](http://images.novusbio.com/fullsize/NET1-Antibody-CL3063-Immunohistochemistry-Paraffin-NBP2-46648-img0011.jpg "Immunohistochemistry-Paraffin: NET1 Antibody (CL3063) [NBP2-46648] - Staining of human prostate shows strong positivity in sympathetic peripheral nerves.")
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_6181.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_23533.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")