Home » NEDD8 » NEDD8 Proteins » NEDD8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NEDD8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NEDD8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEDD8.

Source: E. coli

Amino Acid Sequence: TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NEDD8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68600.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NEDD8 Recombinant Protein Antigen

  • FLJ43224
  • MGC104393
  • MGC125896
  • MGC125897
  • NEDD8
  • NEDD-8
  • Neddylin
  • Neural precursor cell expressed developmentally down-regulated protein 8
  • neural precursor cell expressed, developmentally down-regulated 8
  • Rub1
  • Ubiquitin-like protein Nedd8

Background

NEDD8 (Neural precursor cell-Expressed Developmentally Down-regulated genes) is an ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis (1). NEDD8 has been shown to conjugate to nuclear proteins in a manner analogous to ubiquination and sentrinization. The conjugation process is though to be catalyzed by thee enzymes; E1 (NEDD8-activation), E2 (NEDD8-conjugation) and E3 (NEDD8-ligation). NEDD8 is known to conjugate to Cul-4A and other cullins proteins via the carboxy-terminal Gly residue for ubiquitinylation (3) while NUB1 will negatively regulate its expression (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cullin 1 Antibody
- Azide and BSA Free
NBP3-16092
Western Blot Cullin 1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Cullin 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Cullin 1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Recombinant Human
CAC1 GST (N-Term) Pro ...
H00143384-P01
SDS-PAGE Recombinant Human CAC1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot ALDH9A1 Antibody
Western Blot ALDH9A1 Antibody
Immunohistochemistry-Paraffin ALDH9A1 Antibody
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot ILT6/CD85e/LILRA3 Antibody (2E9)
(6 Publications)
Species: Hu
Applications: ELISA, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/ Immunofluorescence Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
SCF/c-kit Ligand
[Unconjugated]
255-SC
SCF/c-kit Ligand [Unconjugated]
(201 Publications)
Species: Hu
Applications: BA
COPS8 Antibody
H00010920-B01P
Western Blot COPS8 Antibody
Immunocytochemistry/ Immunofluorescence COPS8 Antibody
Western Blot COPS8 Antibody
Species: Hu, Rt
Applications: ICC/IF, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Butyrylcholinesterase/ ...
AF9024
Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]
Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]
(2 Publications)
Species: Mu, Rt
Applications: IHC, WB
MASA Antibody
NBP2-13961
Immunohistochemistry-Paraffin MASA Antibody
Immunohistochemistry-Paraffin MASA Antibody
Immunohistochemistry-Paraffin MASA Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Elastase Antibody
(CELA3B/1257) - Azide ...
NBP2-54301
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
UBE2M/Ubc12
[Unconjugated]
E2-656
UBE2M/Ubc12 [Unconjugated]
(7 Publications)
Species: Hu, Mu, Rt
Applications: EnzAct
RBX1 Antibody
(SR1116)
NBP3-21835
Western Blot RBX1 Antibody (SR1116)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
JAB1 Antibody
(2A10.8)
NB120-495
Western Blot JAB1 Antibody (2A10.8)
Immunohistochemistry JAB1 Antibody (2A10.8)
Western Blot JAB1 Antibody (2A10.8)
(11 Publications)
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
UBA3 Antibody
NBP2-48628
Western Blot UBA3 Antibody
Immunohistochemistry-Paraffin UBA3 Antibody
Immunohistochemistry-Paraffin UBA3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
IL-31RA Antibody
[Unconjugated]
AF2769
Flow Cytometry IL-31RA Antibody [Unconjugated]
Immunocytochemistry IL-31RA Antibody [Unconjugated]
Immunocytochemistry IL-31RA Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
TIP120A Antibody
(5D7)
H00055832-M01
Immunocytochemistry/ Immunofluorescence TIP120A Antibody (5D7)
Immunohistochemistry-Paraffin TIP120A Antibody (5D7)
Western Blot TIP120A Antibody (5D7)
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

Publications for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP) (0)

There are no publications for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP) (0)

There are no reviews for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NEDD8 Products

Research Areas for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP)

Find related products by research area.

Blogs on NEDD8.

Check out the latest blog posts on NEDD8.
PINK1: All work and no fun
The protein PINK1 is a mitochondrial-located serine/threonine kinase (PTK) that maintains organelle function and integrity. It not only protects organelles from cellular stress, but it also uses the selective auto-phagocytosis process for cleaning and...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NEDD8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NEDD8