Novus Biologicals products are now on bio-techne.com

Recombinant Human NAG GST (N-Term) Protein

Name: Recombinant Human NAG GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00051594-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

100% Guarantee on every product

Recombinant Human NAG GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2272-2371 of Human NAG Source: Wheat Germ (in vitro) Amino Acid Sequence: LEQITAVTTVNDSNCDQELLSLLLDAKLLVKCVSTPFYPRIVDHLLASLQQGRWDAEELGRHLREAGHEAEAGSLLLAVRGTHQAFRTFSTALRAAQHWV
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Partial Recombinant Protein
Gene	NBAS
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NAG GST (N-Term) Protein

DKFZp586G1219
EC 1.1.1.94
EC 1.2.1.59
FLJ40407
NAG/BC035112 fusion
NAG/FAM49A fusion
NAGneuroblastoma-amplified protein
neuroblastoma amplified sequence
Neuroblastoma-amplified gene protein
neuroblastoma-amplified sequence

Background

NAG - neuroblastoma-amplified protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

GGT1 Antibody (1F9)

H00002678-M01

Immunohistochemistry-Paraffin GGT1 Antibody (1F9)

(10 Publications)

Species: Hu, Mu, Ye

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB

CD55/DAF Antibody
[Unconjugated]

AF2009

Immunocytochemistry CD55/DAF Antibody [Unconjugated]

(8 Publications)

Species: Hu

Applications: ICC, IHC

Calretinin Antibody

NBP1-88220

Immunohistochemistry-Paraffin Calretinin Antibody

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

CD21 Antibody
(SC0681)

NBP2-67605

Immunohistochemistry-Paraffin CD21 Antibody (SC0681)

(1 Publication)

Species: Hu, Pm, Mu

Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB

DHRS4 Antibody

NBP2-98675

Species: Hu

Applications: IHC-P, IP, WB

CRIPTO Antibody -
BSA Free

NB100-1598

(3 Publications)

Species: Hu, Mu

Applications: Flow, ICC/IF, WB

Serpin F2/alpha
2-Antiplasmin Antibod

AF1239

(4 Publications)

Species: Mu

Applications: IHC, IP, WB

Gamma-glutamyltransfer

NBP2-54724

Western Blot Gamma-glutamyltransferase 2 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

Aminopeptidase
N/CD13 Antibody [Unco ...

AF2335

Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]

(53 Publications)

Species: Mu

Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB

RAPGEF5 Antibody

NBP2-57362

Immunocytochemistry/ Immunofluorescence RAPGEF5 Antibody

Species: Hu

Applications: ICC/IF, WB

RENBP Antibody

NBP1-80851

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

RBP4/Retinol-Binding P

DRB400

(29 Publications)

Species: Hu

Applications: ELISA

SF4 Antibody

NBP1-88000

Immunohistochemistry-Paraffin SF4 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

Lipocalin-2/NGAL
[Biotin]

DY1857

(122 Publications)

Species: Mu

Applications: ELISA

Lysozyme Antibody
- BSA Free

NBP2-61118

Flow Cytometry Lysozyme Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Lysozyme Antibody - BSA Free

(7 Publications)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

Alkaline
Phosphatase/ALPP Anti ...

NB110-3638

Immunohistochemistry-Paraffin Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free

Western Blot Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free

(1 Review)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB

ATRNL1 Antibody

NBP1-89131

Immunocytochemistry/ Immunofluorescence ATRNL1 Antibody

Immunohistochemistry-Paraffin ATRNL1 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

SLPI [HRP]

DPI00

(36 Publications)

Species: Hu

Applications: ELISA

CCL27/CTACK [HRP]

DCC270

(10 Publications)

Species: Hu

Applications: ELISA

Publications for NAG Partial Recombinant Protein (H00051594-Q01) (0)

There are no publications for NAG Partial Recombinant Protein (H00051594-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAG Partial Recombinant Protein (H00051594-Q01) (0)

There are no reviews for NAG Partial Recombinant Protein (H00051594-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAG Partial Recombinant Protein (H00051594-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NAG Products

Research Areas for NAG Partial Recombinant Protein (H00051594-Q01)

Find related products by research area.

Cell Biology

Blogs on NAG

There are no specific blogs for NAG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human NAG GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

NBAS

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human NAG GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human NAG GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human NAG GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for NAG Partial Recombinant Protein (H00051594-Q01) (0)

Reviews for NAG Partial Recombinant Protein (H00051594-Q01) (0)

Product General Protocols

Video Protocols

FAQs for NAG Partial Recombinant Protein (H00051594-Q01) (0)

Additional NAG Products

Research Areas for NAG Partial Recombinant Protein (H00051594-Q01)

Blogs on NAG

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics