Home » N-Deacetylase/N-Sulfotransferase 1/NDST1 » NDST1 Peptides and Proteins » N-Deacetylase/N-Sulfotransferase 1/NDST1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

N-Deacetylase/N-Sulfotransferase 1/NDST1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for N-Deacetylase/N-Sulfotransferase 1/NDST1 Protein (NBP2-37978PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

N-Deacetylase/N-Sulfotransferase 1/NDST1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NDST1.

Source: E. coli

Amino Acid Sequence: YEPVLLAKTRSSESIPHLGADAGLHAALHATVVQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NDST1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37978.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for N-Deacetylase/N-Sulfotransferase 1/NDST1 Recombinant Protein Antigen

  • [Heparan sulfate]-glucosamine N-sulfotransferase 1
  • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
  • EC 2.8.2.8
  • Glucosaminyl N-deacetylase/N-sulfotransferase 1
  • heparan sulfate-N-deacetylase/N-sulfotransferase
  • HSNST 1
  • HSNST1
  • HSST1
  • HSSTN-HSST 1
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
  • NDST1
  • NDST-1
  • N-heparan sulfate sulfotransferase 1
  • NST1

Background

Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine(GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backboneto make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a rolein determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence isabsolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands,thereby playing a role in inflammatory response

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


N-Deacetylase/N-Sulfot ...
NBP2-81747
Western Blot N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NIK/MAP3K14
Antibody - BSA Free
NBP2-23603
Immunocytochemistry/ Immunofluorescence NIK/MAP3K14 Antibody - BSA Free
Immunohistochemistry NIK/MAP3K14 Antibody - BSA Free
Western Blot NIK/MAP3K14 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(555 Publications)
Species: Hu
Applications: BA
NDST3 Antibody
NBP2-19501
Western Blot NDST3 Antibody
Immunohistochemistry-Paraffin NDST3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
SND1 Antibody -
Azide and BSA Free
NBP2-94469
Western Blot SND1 Antibody - Azide and BSA Free
Western Blot SND1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin SND1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NDST4 Antibody
H00064579-D01P
Western Blot NDST4 Antibody
Western Blot NDST4 Antibody
Species: Hu, Rt
Applications: WB
Exostosin 1
Antibody - Azide and ...
NBP3-03736
Western Blot Exostosin 1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Exostosin 1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Exostosin 1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Cytosolic
Sulfotransferase 2B1/ ...
AF6174
Immunohistochemistry Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody
Western Blot Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IP, WB
NLRP1/NALP1
Antibody
NBP1-54899
Western Blot NLRP1/NALP1 Antibody
Western Blot NLRP1/NALP1 Antibody
(22 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Heparan Sulfate
2-O-Sulfotransferase ...
MAB6335
Western Blot Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody (738306)
Species: Hu
Applications: WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
RAPGEF3 Antibody -
BSA Free
NBP2-81767
Western Blot RAPGEF3 Antibody - BSA Free
Immunohistochemistry RAPGEF3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence RAPGEF3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Heparan Sulfate
6-O-Sulfotransferase ...
AF5057
Western Blot Heparan Sulfate 6-O-Sulfotransferase 1/HS6ST1 Antibody
(1 Publication)
Species: Hu
Applications: WB
Ext2 Antibody
NBP1-58297
Western Blot Ext2 Antibody
Immunohistochemistry Ext2 Antibody
Western Blot Ext2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB

Publications for N-Deacetylase/N-Sulfotransferase 1/NDST1 Protein (NBP2-37978PEP) (0)

There are no publications for N-Deacetylase/N-Sulfotransferase 1/NDST1 Protein (NBP2-37978PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Deacetylase/N-Sulfotransferase 1/NDST1 Protein (NBP2-37978PEP) (0)

There are no reviews for N-Deacetylase/N-Sulfotransferase 1/NDST1 Protein (NBP2-37978PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for N-Deacetylase/N-Sulfotransferase 1/NDST1 Protein (NBP2-37978PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional N-Deacetylase/N-Sulfotransferase 1/NDST1 Products

Research Areas for N-Deacetylase/N-Sulfotransferase 1/NDST1 Protein (NBP2-37978PEP)

Find related products by research area.

Blogs on N-Deacetylase/N-Sulfotransferase 1/NDST1

There are no specific blogs for N-Deacetylase/N-Sulfotransferase 1/NDST1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our N-Deacetylase/N-Sulfotransferase 1/NDST1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NDST1