Home » MGAT2 » MGAT2 Proteins » MGAT2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MGAT2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MGAT2 Protein (NBP2-14235PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MGAT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGAT2.

Source: E. coli

Amino Acid Sequence: PSVAVGIRRVSNVSAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MGAT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14235.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MGAT2 Recombinant Protein Antigen

  • alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  • Beta-1,2-N-acetylglucosaminyltransferase II
  • CDG2A
  • EC 2.4.1.143
  • GlcNAc-T II
  • GLCNACTII
  • GNT2
  • GNT-IICDGS2
  • Mannoside acetylglucosaminyltransferase 2
  • mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
  • MGAT2
  • N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase II
  • UDP-N-acetylglucosamine:alpha-6-D-mannosidebeta-1,2-N-acetylglucosaminyltransferase II

Background

The product of the MGAT2 gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complexN-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, ahydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead tocarbohydrate-deficient glycoprotein syndrome, type II. The coding region of this gene is intronless. Transcriptvariants with a spliced 5' UTR may exist, but their biological validity has not been determined. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MGAT1
[Unconjugated]
8334-GT
MGAT1 [Unconjugated]
(3 Publications)
Species: Hu
Applications: EnzAct
MOGAT1 Antibody
NBP1-59769
Western Blot MOGAT1 Antibody
Western Blot MOGAT1 Antibody
Species: Hu
Applications: WB
DGAT1 Antibody -
BSA Free
NB110-41487
Immunocytochemistry/ Immunofluorescence DGAT1 Antibody - BSA Free
Western Blot DGAT1 Antibody - BSA Free
Western Blot DGAT1 Antibody - BSA Free
(1 Review)
(25 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB

N-Acetylglucosaminyltr ...
7359-GT
N-Acetylglucosaminyltransferase III/MGAT3 [Unconjugated]
(1 Publication)
Species: Hu
Applications: EnzAct
MOGAT3 Antibody
(3F7)
H00346606-M05
Immunocytochemistry/ Immunofluorescence MOGAT3 Antibody (3F7)
Species: Hu
Applications: ELISA, ICC/IF, WB
SLC6A12 Antibody
NBP1-88641
Immunocytochemistry/ Immunofluorescence SLC6A12 Antibody
Immunocytochemistry/ Immunofluorescence SLC6A12 Antibody
Western Blot SLC6A12 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
GAT-1/SLC6A1
Antibody
NBP3-13166
Western Blot GAT-1/SLC6A1 Antibody
Immunohistochemistry-Paraffin GAT-1/SLC6A1 Antibody
Immunohistochemistry-Paraffin GAT-1/SLC6A1 Antibody
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Dystroglycan
Antibody [Unconjugate
AF6868
Immunohistochemistry Dystroglycan Antibody [Unconjugated]
Western Blot Dystroglycan Antibody [Unconjugated]
Knockout Validated Dystroglycan Antibody [Unconjugated]
(23 Publications)
Species: Hu
Applications: IHC, KO, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
DGAT2 Antibody -
BSA Free
NBP1-71701
Western Blot DGAT2 Antibody - BSA Free
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB
Ets-1 Antibody
[Unconjugated]
AF7284
Western Blot Ets-1 Antibody [Unconjugated]
Immunohistochemistry Ets-1 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, WB
MAG/Siglec-4a
538-MG
MAG/Siglec-4a
(19 Publications)
Species: Rt
Applications: BA
GABA Transporter 2
Antibody
NB100-1872
Western Blot GABA Transporter 2 Antibody
Western Blot GABA Transporter 2 Antibody
Western Blot GABA Transporter 2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, WB
GIP Antibody
(911205) [Unconjugate
MAB8864
Immunohistochemistry GIP Antibody (911205) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC

N-Acetylglucosaminyltr ...
MAB5469
Immunocytochemistry N-Acetylglucosaminyltransferase V/MGAT5 Antibody (706824)
Western Blot N-Acetylglucosaminyltransferase V/MGAT5 Antibody (706824)
(5 Publications)
Species: Hu
Applications: ICC, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Peptide YY Antibody
NBP1-80865
Immunohistochemistry-Paraffin Peptide YY Antibody
Immunohistochemistry-Paraffin Peptide YY Antibody
Immunohistochemistry-Paraffin Peptide YY Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P

Publications for MGAT2 Protein (NBP2-14235PEP) (0)

There are no publications for MGAT2 Protein (NBP2-14235PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGAT2 Protein (NBP2-14235PEP) (0)

There are no reviews for MGAT2 Protein (NBP2-14235PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MGAT2 Protein (NBP2-14235PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MGAT2 Products

Blogs on MGAT2

There are no specific blogs for MGAT2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: DGAT1 Antibody [NB110-41487] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-DGAT1 at 5 ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
DGAT1 Antibody - BSA Free
NB110-41487

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MGAT2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MGAT2