Home » MED17 » MED17 Proteins » MED17 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MED17 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MED17 Recombinant Protein Antigen (NBP3-17737PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MED17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED17

Source: E. coli

Amino Acid Sequence: IGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17737.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED17 Recombinant Protein Antigen

  • Activator-recruited cofactor 77 kDa component
  • Cofactor required for Sp1 transcriptional activation subunit 6
  • cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa
  • CRSP6FLJ10812
  • CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD)
  • DRIP77
  • DRIP80ARC77
  • mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component
  • mediator of RNA polymerase II transcription subunit 17
  • Thyroid hormone receptor-associated protein complex 80 kDa component
  • Transcriptional coactivator CRSP77
  • Trap80
  • TRAP80CRSP complex subunit 6

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TRAP220/MED1
Antibody
AF5520
Western Blot TRAP220/MED1 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
MED14 Antibody
NBP2-83187
Western Blot MED14 Antibody
Chromatin Immunoprecipitation MED14 Antibody
Species: Hu
Applications: ChIP, WB
MBD4 Antibody -
BSA Free
NBP1-91189
Immunocytochemistry/ Immunofluorescence MBD4 Antibody - BSA Free
Immunohistochemistry MBD4 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
CDK8 Antibody -
BSA Free
NBP2-92972
Western Blot CDK8 Antibody - BSA Free
Western Blot CDK8 Antibody - BSA Free
Western Blot CDK8 Antibody - BSA Free
(1 Review)
Species: Hu, Mu, Rt
Applications: IP, KO, WB
MED12 Antibody
NB100-2357
Immunohistochemistry MED12 Antibody
Western Blot MED12 Antibody
Western Blot MED12 Antibody
(13 Publications)
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
MED6 Antibody
H00010001-D01P
Western Blot MED6 Antibody
Western Blot MED6 Antibody
Western Blot MED6 Antibody
Species: Hu, Mu
Applications: WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MED8 Antibody
NBP1-89014
Western Blot MED8 Antibody
Immunohistochemistry-Paraffin MED8 Antibody
Immunocytochemistry/ Immunofluorescence MED8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MED23 Antibody
NB200-337
Immunoprecipitation MED23 Antibody
(5 Publications)
Species: Hu, Mu
Applications: ChIP, IP, WB (-)
MED7 Antibody (3E7)
H00009443-M01
Western Blot MED7 Antibody (3E7)
Sandwich ELISA MED7 Antibody (3E7)
Western Blot MED7 Antibody (3E7)
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
SURF5 Antibody
(PCRP-MED22-1E4)
NBP3-13787
Flow Cytometry SURF5 Antibody (PCRP-MED22-1E4)
Immunocytochemistry/ Immunofluorescence SURF5 Antibody (PCRP-MED22-1E4)
Protein Array SURF5 Antibody (PCRP-MED22-1E4)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
TRACP/PAP/ACP5
Antibody
H00000054-D01P
Western Blot TRACP/PAP/ACP5 Antibody
Western Blot TRACP/PAP/ACP5 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Transgelin/TAGLN/SM22
NB600-507
Western Blot Transgelin/TAGLN/SM22 alpha Antibody
Immunohistochemistry-Paraffin Transgelin/TAGLN/SM22 alpha Antibody
Western Blot Transgelin/TAGLN/SM22 alpha Antibody
(1 Review)
(24 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
CD40 Ligand/TNFSF5
[HRP]
DCDL40
N/A CD40 Ligand/TNFSF5 [HRP]
N/A CD40 Ligand/TNFSF5 [HRP]
(44 Publications)
Species: Hu
Applications: ELISA
MED11 Antibody
NBP2-34162
Immunohistochemistry-Paraffin MED11 Antibody
Immunocytochemistry/ Immunofluorescence MED11 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SCYL1 Antibody
(2E5)
H00057410-M02
Sandwich ELISA SCYL1 Antibody (2E5)
Western Blot SCYL1 Antibody (2E5)
Western Blot SCYL1 Antibody (2E5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
TDRD7 Antibody
NBP1-87315
Immunohistochemistry TDRD7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
MED24 Antibody
NB100-74599
Western Blot MED24 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IP, WB
Calponin 1
Antibody (CALP)
NBP2-44479
Western Blot Calponin 1 Antibody (CALP)
Flow Cytometry Calponin 1 Antibody (CALP)
Immunocytochemistry/ Immunofluorescence Calponin 1 Antibody (CALP)
(1 Publication)
Species: Hu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB

Publications for MED17 Recombinant Protein Antigen (NBP3-17737PEP) (0)

There are no publications for MED17 Recombinant Protein Antigen (NBP3-17737PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED17 Recombinant Protein Antigen (NBP3-17737PEP) (0)

There are no reviews for MED17 Recombinant Protein Antigen (NBP3-17737PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED17 Recombinant Protein Antigen (NBP3-17737PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED17 Products

Research Areas for MED17 Recombinant Protein Antigen (NBP3-17737PEP)

Find related products by research area.

Blogs on MED17

There are no specific blogs for MED17, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED17 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MED17