Novus Biologicals products are now on bio-techne.com

Recombinant Human LSS GST (N-Term) Protein

Name: Recombinant Human LSS GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004047-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

SDS-Page: Recombinant Human LSS Protein [H00004047-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human LSS GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 633-732 of Human LSS Source: Wheat Germ (in vitro) Amino Acid Sequence: FESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	LSS
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array SDS-Page Western Blot
Theoretical MW	36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LSS GST (N-Term) Protein

EC 5.4.99.7
FLJ350152,3-epoxysqualene--lanosterol cyclase
FLJ39450
FLJ46393
hOSC
human lanosterol synthase, EC 5.4.99.710EC 5.4.99
lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)2,3-epoxysqualene-lanosterol cyclase
lanosterol synthase
LSS
OSC
OSCFLJ25486
Oxidosqualene--lanosterol cyclase

Background

The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cathepsin C/DPPI
Antibody [Unconjugate ...

AF1034

Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]

(13 Publications)

Species: Mu, Rt

Applications: IHC, Simple Western, WB

FDFT1 Antibody
(OTI2F10)

NBP2-01170

Immunohistochemistry-Paraffin FDFT1 Antibody (OTI2F10)

Species: Hu, Pm, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, WB

SQLE Antibody -
Azide and BSA Free

NBP2-93808

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(811 Publications)

Species: Hu

Applications: BA

Sulfamidase/SGSH
Antibody

NBP1-83164

Immunohistochemistry-Paraffin Sulfamidase/SGSH Antibody

Species: Hu

Applications: IHC, IHC-P, WB

SPAG9 Antibody

NBP1-85393

Immunohistochemistry-Paraffin SPAG9 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

PANK2 Antibody
(OTI3H9)

NBP2-02677

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

GFER/ALR Antibody
(829812)

MAB7940

(1 Publication)

Species: Hu

Applications: IHC, WB

NOC2L Antibody

NBP1-92190

Immunohistochemistry-Paraffin NOC2L Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB

MID1 Antibody -
BSA Free

NBP3-05061

Species: Hu, Mu

Applications: ICC/IF, WB

Osteocalcin
Antibody (190125)

MAB1419

Immunocytochemistry Osteocalcin Antibody (190125)

(3 Reviews)

(56 Publications)

Species: Hu, Rt

Applications: CyTOF-ready, ICC, IHC, ICFlow

Glutaminyl-peptide
Cyclotransferase/QPCT ...

NBP1-81838

Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody

Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody

(1 Publication)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

hnRNP C1 + C2
Antibody (CL2593)

NBP2-36776

Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

LIGHT/TNFSF14
[Unconjugated]

664-LI

Bioactivity LIGHT/TNFSF14 [Unconjugated]

(21 Publications)

Species: Hu

Applications: BA

Acetylcholinesterase/A

NB100-1519

Western Blot Acetylcholinesterase/ACHE Antibody

Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB

Dehydrodolichyl
Diphosphate Synthase ...

NBP1-87964

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

Osteopontin/OPN
Antibody [Unconjugate

AF808

Neutralization Osteopontin/OPN Antibody [Unconjugated]

Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]

(2 Reviews)

(206 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB

eNOS Antibody -
BSA Free

NB300-500

Immunohistochemistry-Paraffin eNOS Antibody - BSA Free

(3 Reviews)

(28 Publications)

Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh

Applications: IHC, IHC-Fr, IHC-P, WB

Publications for LSS Partial Recombinant Protein (H00004047-Q01) (0)

There are no publications for LSS Partial Recombinant Protein (H00004047-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSS Partial Recombinant Protein (H00004047-Q01) (0)

There are no reviews for LSS Partial Recombinant Protein (H00004047-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LSS Partial Recombinant Protein (H00004047-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LSS Products

Blogs on LSS

There are no specific blogs for LSS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteopontin/OPN Antibody [Unconjugated]
AF808

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human LSS GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

LSS

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human LSS GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human LSS GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human LSS GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for LSS Partial Recombinant Protein (H00004047-Q01) (0)

Reviews for LSS Partial Recombinant Protein (H00004047-Q01) (0)

Product General Protocols

Video Protocols

FAQs for LSS Partial Recombinant Protein (H00004047-Q01) (0)

Additional LSS Products

Blogs on LSS

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics