![Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: HT1080. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HT1080](http://images.novusbio.com/fullsize/LAS1L-Antibody-Western-Blot-NBP2-85201-img0006.jpg "Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: HT1080. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HT1080")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L. Peptide sequence: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LAS1L |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LAS1L |
![Western Blot: LAS1L Antibody [NBP2-85201] - WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate](http://images.novusbio.com/fullsize/LAS1L-Antibody-Western-Blot-NBP2-85201-img0001.jpg "Western Blot: LAS1L Antibody [NBP2-85201] - WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate")
![Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: COLO205. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in COLO205](http://images.novusbio.com/fullsize/LAS1L-Antibody-Western-Blot-NBP2-85201-img0002.jpg "Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: COLO205. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in COLO205")
![Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: MCF7. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in MCF7](http://images.novusbio.com/fullsize/LAS1L-Antibody-Western-Blot-NBP2-85201-img0003.jpg "Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: MCF7. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in MCF7")
![Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: Hela. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HeLa](http://images.novusbio.com/fullsize/LAS1L-Antibody-Western-Blot-NBP2-85201-img0004.jpg "Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: Hela. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in HeLa")
![Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: OVCAR-3. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3](http://images.novusbio.com/fullsize/LAS1L-Antibody-Western-Blot-NBP2-85201-img0005.jpg "Western Blot: LAS1L Antibody [NBP2-85201] - Host: Rabbit. Target Name: LAS1L. Sample Type: OVCAR-3. Antibody Dilution: 1.0ug/mlLAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")