Home » IGSF2/CD101 » IGSF2/CD101 Proteins » Recombinant Human IGSF2/CD101 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human IGSF2/CD101 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human IGSF2/CD101 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 653-759 of Human IGSF2/CD101

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NRPPRASAISHPLRIAVTLPESKLKVNSRSQGQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQD
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CD101
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IGSF2/CD101 GST (N-Term) Protein

  • CD101 antigen
  • CD101 molecule
  • CD101
  • Cell surface glycoprotein V7
  • EWI101
  • EWI-101
  • Glu-Trp-Ile EWI motif-containing protein 101
  • IGSF2
  • Leukocyte Surface Protein
  • member 2
  • V7

Background

IGSF2 - immunoglobulin superfamily, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Recombinant Human
IGKV1-5 GST (N-Term) ...
H00028299-P01
Other Recombinant Human IGKV1-5 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Growth Hormone R
Antibody
AF1360
Immunohistochemistry Growth Hormone R Antibody
(8 Publications)
Species: Mu
Applications: IHC, WB
ATN1 Antibody
NBP1-90044
Immunocytochemistry/ Immunofluorescence ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
Immunohistochemistry-Paraffin ATN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IGSF8/CD316
Antibody [Unconjugate
AF3117
Flow Cytometry IGSF8/CD316 Antibody [Unconjugated]
Western Blot IGSF8/CD316 Antibody [Unconjugated]
Western Blot IGSF8/CD316 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(45 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
IGSF3 Antibody
[Unconjugated]
AF4788
Flow Cytometry IGSF3 Antibody [Unconjugated]
Western Blot IGSF3 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
CD28 Antibody
(37407) [Unconjugated
MAB342
Agonist Activity CD28 Antibody (37407) [Unconjugated]
Immunocytochemistry CD28 Antibody (37407) [Unconjugated]
(1 Review)
(49 Publications)
Species: Hu
Applications: AgAct, ICC, WB
NRAMP1/SLC11A1
Antibody (910825)
MAB8400
Western Blot NRAMP1/SLC11A1 Antibody (910825)
Flow Cytometry NRAMP1/SLC11A1 Antibody (910825)
Species: Hu
Applications: CyTOF-ready, Flow, WB
L-Selectin/CD62L
Antibody (4G8) [Uncon ...
BBA24
Flow Cytometry L-Selectin/CD62L Antibody (4G8) [Unconjugated]
(9 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
CD25/IL-2R alpha
[HRP]
DR2A00
N/A CD25/IL-2R alpha [HRP]
N/A CD25/IL-2R alpha [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
DGCR2 Antibody
NBP1-84255
Immunohistochemistry-Paraffin DGCR2 Antibody
Immunohistochemistry-Paraffin DGCR2 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
COL9A3 Antibody
H00001299-D01P
Western Blot COL9A3 Antibody
Western Blot COL9A3 Antibody
Species: Hu
Applications: WB

4-1BB/TNFRSF9/CD137 An ...
AF838
Flow Cytometry 4-1BB/TNFRSF9/CD137 Antibody [Unconjugated]
Western Blot 4-1BB/TNFRSF9/CD137 Antibody [Unconjugated]
Immunohistochemistry 4-1BB/TNFRSF9/CD137 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB

Publications for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01) (0)

There are no publications for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01) (0)

There are no reviews for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGSF2/CD101 Products

Blogs on IGSF2/CD101

There are no specific blogs for IGSF2/CD101, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010
Human CD28 Monoclonal Antibody enhances IL-2 secretion in the Jurkat human acute T cell leukemia cell line stimulated with 10 ng/mL phorbol myristate acetate (PMA) and 0.5 μM calcium ionophore, in a dose-dependent manner, as measured using the Quantikine Human IL-2 ELISA Kit (Catalog # D2050). The ED50 for this effect is typically 0.2-0.6 μg/mL.
CD28 Antibody (37407) [Unconjugated]
MAB342-100
Immunohistochemistry-Frozen: CD3 Antibody (SP7) [NB600-1441] - T-cells and microglia in mouse spinal cord with acute EAE. Mouse was perfused with 4% paraformaldehyde. Spinal cord was post-fixed overnight, followed by cryoprotection with 30% sucrose for 24h. Spinal cord sections were treated with antigen-retrieval buffer (pH 6.0) at 60C for 10 min, then cooled down to room temperature (this step should not be omitted). Anti-CD3 antibody was diluted at 1:200. Incubation: room temperature overnight. IHC-Fr image submitted by a verified customer review.
CD3 Antibody (SP7)
NB600-1441

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IGSF2/CD101 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol CD101