![Sandwich ELISA: GSTO1 Antibody (3D9) [H00009446-M01] - Detection limit for recombinant GST tagged GSTO1 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/GSTO1-Antibody-3D9-Sandwich-ELISA-H00009446-M01-img0004.jpg "Sandwich ELISA: GSTO1 Antibody (3D9) [H00009446-M01] - Detection limit for recombinant GST tagged GSTO1 is approximately 0.03ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IP |
| Clone | 3D9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | GSTO1 (NP_004823, 121 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKED |
| Specificity | GSTO1 - glutathione S-transferase omega 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | GSTO1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry IL-17D Antibody (246018) [Unconjugated]](https://images.novusbio.com/images2/IL-17D_MAB15041_Immunohistochemistry_6949.jpg)
![Intracellular Staining by Flow Cytometry IL-17D Antibody (246018) [Unconjugated]](https://images.novusbio.com/images2/IL-17D_MAB15041_Flow_Cytometry_8338.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunoprecipitation: GSTO1 Antibody (3D9) [H00009446-M01] - Analysis of GSTO1 transfected lysate using anti-GSTO1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSTO1 MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/GSTO1-Antibody-3D9-Immunoprecipitation-H00009446-M01-img0003.jpg "Immunoprecipitation: GSTO1 Antibody (3D9) [H00009446-M01] - Analysis of GSTO1 transfected lysate using anti-GSTO1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSTO1 MaxPab rabbit polyclonal antibody.")
![IL-27 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-27 [Unconjugated]")
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")