Home » GPSM2 » GPSM2 Proteins » GPSM2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GPSM2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GPSM2 Protein (NBP1-85231PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GPSM2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPSM2.

Source: E. coli

Amino Acid Sequence: FQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPSM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85231.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPSM2 Recombinant Protein Antigen

  • deafness, autosomal recessive 82
  • DFNB82
  • G-protein signaling modulator 2
  • G-protein signalling modulator 2 (AGS3-like, C. elegans)
  • G-protein-signaling modulator 2
  • LGNPins
  • Mosaic protein LGN
  • PINS

Background

Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins (Blumer et al., 2002).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
IGKV1-5 GST (N-Term) ...
H00028299-P01
Other Recombinant Human IGKV1-5 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
WIRE Antibody
NBP1-86856
Western Blot WIRE Antibody
Immunohistochemistry-Paraffin WIRE Antibody
Immunohistochemistry-Paraffin WIRE Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NuMA Antibody
NB500-174
Immunocytochemistry/ Immunofluorescence NuMA Antibody
Immunocytochemistry/ Immunofluorescence NuMA Antibody
Western Blot NuMA Antibody
(27 Publications)
Species: Hu, Ma, Mar, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
ATP6V0A1 Antibody
NBP1-89342
Immunocytochemistry/ Immunofluorescence ATP6V0A1 Antibody
Immunohistochemistry-Paraffin ATP6V0A1 Antibody
Immunohistochemistry-Paraffin ATP6V0A1 Antibody
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
RFC2 Antibody
(OTI2B2)
NBP2-45570
Flow Cytometry RFC2 Antibody (OTI2B2)
Immunohistochemistry RFC2 Antibody (OTI2B2)
Immunohistochemistry RFC2 Antibody (OTI2B2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
RFC1 Antibody
[Unconjugated]
AF6457
Western Blot RFC1 Antibody [Unconjugated]
Species: Hu
Applications: WB
RFC4 Antibody
(OTI1A8)
NBP2-45946
Immunocytochemistry/ Immunofluorescence RFC4 Antibody (OTI1A8)
Immunohistochemistry RFC4 Antibody (OTI1A8)
Immunohistochemistry RFC4 Antibody (OTI1A8)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERMAP Antibody
[Unconjugated]
AF4928
Flow Cytometry ERMAP Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow, WB
PIN/DLC8 Antibody
[Unconjugated]
AF877
PIN/DLC8 Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: IHC, IP, WB
GPSM1 Antibody
NBP1-91968
Immunocytochemistry/ Immunofluorescence GPSM1 Antibody
Immunohistochemistry-Paraffin GPSM1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ATP Citrate Lyase
Antibody
NBP1-90267
Immunocytochemistry/ Immunofluorescence ATP Citrate Lyase Antibody
Western Blot ATP Citrate Lyase Antibody
Western Blot ATP Citrate Lyase Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CtBP1 Antibody
(2G7)
H00001487-M01
Western Blot CtBP1 Antibody (2G7)
Immunocytochemistry/ Immunofluorescence CtBP1 Antibody (2G7)
Immunohistochemistry-Paraffin CtBP1 Antibody (2G7)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
PARD3/Par3 Antibody
NBP1-88861
Immunohistochemistry-Paraffin PARD3/Par3 Antibody
Immunohistochemistry-Paraffin PARD3/Par3 Antibody
Immunohistochemistry-Paraffin PARD3/Par3 Antibody
(2 Reviews)
(10 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
SS18L1 Antibody
NBP2-20486
Immunoprecipitation SS18L1 Antibody
Immunohistochemistry-Paraffin SS18L1 Antibody
Immunocytochemistry/ Immunofluorescence SS18L1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
GRIP1 Antibody -
BSA Free
NBP2-41211
Western Blot GRIP1 Antibody - BSA Free
Immunohistochemistry GRIP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRIP1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for GPSM2 Protein (NBP1-85231PEP) (0)

There are no publications for GPSM2 Protein (NBP1-85231PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPSM2 Protein (NBP1-85231PEP) (0)

There are no reviews for GPSM2 Protein (NBP1-85231PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPSM2 Protein (NBP1-85231PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPSM2 Products

Research Areas for GPSM2 Protein (NBP1-85231PEP)

Find related products by research area.

Blogs on GPSM2

There are no specific blogs for GPSM2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.
Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPSM2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GPSM2