Novus Biologicals products are now on bio-techne.com

GPR137B Recombinant Protein Antigen

Name: GPR137B Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-86934PEP
Price: 289 USD

Images

There are currently no images for GPR137B Protein (NBP1-86934PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

GPR137B Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR137B. Source: E. coli Amino Acid Sequence: RVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	GPR137B
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86934. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR137B Recombinant Protein Antigen

G protein-coupled receptor 137B
TM7SF1
transmembrane 7 superfamily member 1 (upregulated in kidney)

Background

TM7SF1 is an Orphan-U GPCR with an unknown ligand. This receptor has been shown to be upregulated during kidney development. TM7SF1 has been reported to be expressed in adult kidney and heart, but not in fetal kidney. ESTs have been isolated from a wide variety of tissues, including B-cell/lung/testis, brain, connective tissue, ear, embryo, eye, gall bladder, kidney, liver/spleen, lung, melanocyte/uterus/fetal heart, nerve, pineal, placenta, skin, spleen, testis, tonsil, and vessel libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LAMP-1/CD107a
Antibody - BSA Free

NB120-19294

Immunocytochemistry/ Immunofluorescence LAMP-1/CD107a Antibody - BSA Free

(2 Reviews)

(38 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

LAMP-2/CD107b
Antibody (H4B4) - BSA ...

NBP2-22217

Immunocytochemistry/ Immunofluorescence LAMP-2/CD107b Antibody (H4B4) - BSA Free

Western Blot LAMP-2/CD107b Antibody (H4B4) - BSA Free

(2 Reviews)

(31 Publications)

Species: Ch, Hu, Mu, Rt(-)

Applications: CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

SLC26A9 Antibody -
BSA Free

NBP2-30425

(3 Publications)

Species: Ha, Hu

Applications: ICC/IF, IHC, IHC-P

ARHGEF3 Antibody -
BSA Free

NBP2-15456

Immunohistochemistry-Paraffin ARHGEF3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence ARHGEF3 Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Flightless I
Antibody - BSA Free

NBP1-87925

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

SLP-76/LCP2 [p
Tyr145] Antibody (776 ...

MAB7474

Western Blot SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]

Immunocytochemistry SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]

Species: Hu

Applications: ICC, Simple Western, WB

FLI1 Antibody -
BSA Free

NBP2-16500

Species: Hu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

Mas Antibody - BSA
Free

NBP1-78444

Immunocytochemistry/ Immunofluorescence Mas Antibody - BSA Free

Immunohistochemistry Mas Antibody - BSA Free

(2 Reviews)

(21 Publications)

Species: Hu, Mu, Pm, Rb, Rt

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

TC-PTP/PTPN2
Antibody (252294) [Un ...

MAB1930

(7 Publications)

Species: Hu, Mu, Rt

Applications: WB

Slit1
[Unconjugated]

6514-SL

(2 Publications)

Species: Hu

Applications: BA

ARC/NOL3 Antibody

NBP2-19561

Immunohistochemistry-Frozen ARC/NOL3 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Slit3 Antibody
(782619)

MAB3629

(1 Publication)

Species: Mu

Applications: IHC

LAF4 Antibody -
BSA Free

NBP2-54913

(1 Publication)

Species: Hu

Applications: ICC/IF

ARC/ARG3.1
Antibody - BSA Free

NBP1-56929

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

EHF Antibody - BSA
Free

NBP2-38896

Species: Hu

Applications: IHC, IHC-P

IGFBP-2 Antibody
[Unconjugated]

AF674

Simple Western IGFBP-2 Antibody [Unconjugated]

Neutralization IGFBP-2 Antibody [Unconjugated]

(12 Publications)

Species: Hu

Applications: Neut, Simple Western, WB

CCL21/6Ckine
[Unconjugated]

366-6C

(35 Publications)

Species: Hu

Applications: BA

IL-1 alpha/IL-1F1

200-LA

(65 Publications)

Species: Hu

Applications: BA

Publications for GPR137B Protein (NBP1-86934PEP) (0)

There are no publications for GPR137B Protein (NBP1-86934PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR137B Protein (NBP1-86934PEP) (0)

There are no reviews for GPR137B Protein (NBP1-86934PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPR137B Protein (NBP1-86934PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR137B Products

Blogs on GPR137B

There are no specific blogs for GPR137B, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

ELISA: LAMP-2/CD107b Antibody (H4B4) [NBP2-22217] - Anti-LAMP-2/CD107b was used to assess lysates from human SVG-A cells via ELISA, by loading the indicated mass of total protein per well. Antibodies tested were diluted 1:250, and used in conjunction with an HRP-conjugated secondary antibody. Signal was detected by luminescence. Image from verified customer review.

LAMP-2/CD107b Antibody (H4B4) - BSA Free
NBP2-22217

Western Blot: LAMP-1/CD107a Antibody [NB120-19294] - Analysis of 20 ug of HeLa cell lysate and 5 ul of Molecular Weight Protein Ladder per well.

LAMP-1/CD107a Antibody - BSA Free
NB120-19294

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our GPR137B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

GPR137B

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

GPR137B Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

GPR137B Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for GPR137B Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for GPR137B Protein (NBP1-86934PEP) (0)

Reviews for GPR137B Protein (NBP1-86934PEP) (0)

FAQs for GPR137B Protein (NBP1-86934PEP) (0)

Additional GPR137B Products

Blogs on GPR137B

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics