Home » GGCX » GGCX Proteins » GGCX Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GGCX Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GGCX Protein (NBP1-80624PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GGCX Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GGCX.

Source: E. coli

Amino Acid Sequence: FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GGCX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80624.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GGCX Recombinant Protein Antigen

  • EC 4.1.1.90
  • gamma-glutamyl carboxylaseFLJ26629
  • GC
  • GGCX
  • Peptidyl-glutamate 4-carboxylase
  • Vitamin K gamma glutamyl carboxylase
  • vitamin K-dependent gamma-carboxylase
  • VKCFD1

Background

Gamma-glutamyl carboxylase (GGCX) mediates the vitamin K-dependent carboxylation of glutamate residues to calcium binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide. GGCX accomplishes the posttranslational modification required for the activity of all of the vitamin K-dependent proteins. These include some of the blood coagulation and anticoagulation proteins as well as bone gamma-carboxyglutamic acid (Gla) protein (BGLAP) and bone matrix protein (MGP)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

VKORC1 Antibody
NBP3-12232
Immunohistochemistry-Paraffin VKORC1 Antibody
Immunohistochemistry-Paraffin VKORC1 Antibody
Western Blot VKORC1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Cytochrome P450
2C9 Antibody (OTI1D7)
NBP2-01397
Flow Cytometry Cytochrome P450 2C9 Antibody (OTI1D7)
Western Blot Cytochrome P450 2C9 Antibody (OTI1D7)
Immunohistochemistry-Paraffin Cytochrome P450 2C9 Antibody (OTI1D7)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Calumenin Antibody
- BSA Free
NBP2-92901
Immunocytochemistry/ Immunofluorescence Calumenin Antibody - BSA Free
Immunohistochemistry-Paraffin Calumenin Antibody - BSA Free
Immunohistochemistry-Paraffin Calumenin Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NAT8 Antibody
(OTI5A8)
NBP1-47863
Western Blot NAT8 Antibody (OTI5A8)
Immunohistochemistry-Paraffin NAT8 Antibody (OTI5A8)
Immunohistochemistry-Paraffin NAT8 Antibody (OTI5A8)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular) Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
(2 Reviews)
(38 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB

alpha-Galactosidase A/ ...
6146-GH
Enzyme Activity alpha-Galactosidase A/GLA [Unconjugated]
Enzyme Activity alpha-Galactosidase A/GLA [Unconjugated]
SDS-PAGE alpha-Galactosidase A/GLA [Unconjugated]
(3 Publications)
Species: Hu
Applications: EnzAct
Osteocalcin
Antibody (190125)
MAB1419
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Immunocytochemistry Osteocalcin Antibody (190125)
(3 Reviews)
(56 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
MRP6 Antibody
(M6II-7)
NBP1-42342
MRP6 Antibody (M6II-7)
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), WB
CYP4F2 Antibody
NBP1-86461
Immunohistochemistry CYP4F2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
EPHX1 Antibody
NBP1-83969
Immunohistochemistry-Paraffin EPHX1 Antibody
Immunohistochemistry-Paraffin EPHX1 Antibody
Immunohistochemistry-Paraffin EPHX1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
TEAD1 Antibody -
Azide and BSA Free
NBP2-94035
Chromatin Immunoprecipitation TEAD1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free
Western Blot TEAD1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MGP Antibody
(OTI11G6)
NBP2-45844
Immunohistochemistry MGP Antibody (OTI11G6)
Immunohistochemistry MGP Antibody (OTI11G6)
Immunohistochemistry MGP Antibody (OTI11G6)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

Publications for GGCX Protein (NBP1-80624PEP) (0)

There are no publications for GGCX Protein (NBP1-80624PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGCX Protein (NBP1-80624PEP) (0)

There are no reviews for GGCX Protein (NBP1-80624PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GGCX Protein (NBP1-80624PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GGCX Products

Research Areas for GGCX Protein (NBP1-80624PEP)

Find related products by research area.

Blogs on GGCX

There are no specific blogs for GGCX, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GGCX Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GGCX