Novus Biologicals products are now on bio-techne.com

FASTK Recombinant Protein Antigen

Name: FASTK Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84729PEP
Price: 279 USD

Images

There are currently no images for FASTK Protein (NBP1-84729PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FASTK Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FASTK. Source: E. coli Amino Acid Sequence: GQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQAL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	FASTK
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84729. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FASTK Recombinant Protein Antigen

EC 2.7.11.8
Fas-activated serine/threonine kinase
FASTFAST kinase

Background

FASTK is encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FoxH1 Antibody
[Unconjugated]

AF4248

(2 Publications)

Species: Hu

Applications: ICC, WB

SUB1 Antibody

NBP1-82454

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

TIA1 Antibody
(OTI1D7)

NBP2-46132

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Fas/TNFRSF6/CD95
Antibody - BSA Free

NB120-13550

Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free

Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free

(1 Review)

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

S100A9 Antibody
[Unconjugated]

AF2065

Immunohistochemistry S100A9 Antibody [Unconjugated]

(2 Reviews)

(34 Publications)

Species: Mu

Applications: ICC, IHC, Simple Western, WB

RPP14 Antibody

NBP1-80965

Immunocytochemistry/ Immunofluorescence RPP14 Antibody

Immunohistochemistry-Paraffin RPP14 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

CDK2AP2 Antibody

H00010263-B01P

Species: Hu, Mu, Rt

Applications: WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

SF3B14 Antibody

NBP1-87431

Immunohistochemistry-Paraffin SF3B14 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ROBLD3 Antibody

NBP1-71687

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

SLC6A3/DAT1
Antibody (mAb16)

NBP2-22164

Immunohistochemistry-Paraffin SLC6A3/DAT1 Antibody (mAb16)

(3 Reviews)

(14 Publications)

Species: Hu(-), Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Doppel Antibody

NBP2-31928

Species: Hu

Applications: IHC, IHC-P

BAAT Antibody -
BSA Free

NBP2-92503

Immunohistochemistry-Paraffin BAAT Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence BAAT Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(803 Publications)

Species: Hu

Applications: BA

PTPLA
Overexpression Lysate

NBL1-14964

Species: Hu

Applications: WB

CAP1 Antibody

NBP1-86644

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Calpastatin
Antibody (OTI1E7)

NBP2-01819

Western Blot Calpastatin Antibody (OTI1E7)

Immunohistochemistry-Paraffin Calpastatin Antibody (OTI1E7)

Species: Hu

Applications: Flow, IHC, IHC-P, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

Publications for FASTK Protein (NBP1-84729PEP) (0)

There are no publications for FASTK Protein (NBP1-84729PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FASTK Protein (NBP1-84729PEP) (0)

There are no reviews for FASTK Protein (NBP1-84729PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FASTK Protein (NBP1-84729PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FASTK Products

Research Areas for FASTK Protein (NBP1-84729PEP)

Find related products by research area.

Apoptosis

Blogs on FASTK

There are no specific blogs for FASTK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.

p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our FASTK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

FASTK

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

FASTK Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

FASTK Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for FASTK Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for FASTK Protein (NBP1-84729PEP) (0)

Reviews for FASTK Protein (NBP1-84729PEP) (0)

FAQs for FASTK Protein (NBP1-84729PEP) (0)

Additional FASTK Products

Research Areas for FASTK Protein (NBP1-84729PEP)

Blogs on FASTK

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics