Reactivity | HuSpecies Glossary |
Applications | AC |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FANCD2. Source: E. coli Amino Acid Sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source | E. coli |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | FANCD2 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57171. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW | 164.1 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for FANCD2 Recombinant Protein Antigen (NBP2-57171PEP)Find related products by research area.
|
Sample collection from mammalian culture cells for kinomic analysis By Jamshed Arslan Pharm.D., PhD.IntroductionKinome describes kinases, and kinomics refers to the kinase signaling. Studying the effects of reagent (exogenously applied growth factor or inhibitor) on kinase activit... Read full blog post. |
FANCD2 and DNA damage repair Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t... Read full blog post. |
FANCD2 (Fanconi anemia subunit D2 protein) Fanconi anemia (FANC) is a rare, autosomal-recessive genetic disorder that is a heterogeneous cancer susceptibility condition that manifests with a wide range of symptoms such as congenital malformations, deteriorating bone marrow failure, DNA-dama... Read full blog post. |
FANCD2: A big component of the DNA repair crew The genetic disorder known as Fanconi anemia (FANC) is a heterogeneous, autosomal-recessive cancer susceptibility condition characterized by a wide array of symptoms. These include congenital malformations, progressive bone marrow failure, DNA-damage ... Read full blog post. |
FANCD2: DNA Repair and Beyond Fanconi anemia (FANC) is a heterogenous, autosomal-recessive cancer susceptibility genetic disorder that is characterized by a wide array of symptoms, including congenital defects, progressive bone marrow failure due to DNA-damage hypersensitivity, ch... Read full blog post. |
NUP153 & 53BP1: A Novel DNA Repair Pathway Mediating DNA damage is a crucial process, and one of the most important cellular guards against cancer. In response to DNA damage, sophisticated cellular machinery is recruited to repair the breaks, and if it fails, the cell is committed to death. De... Read full blog post. |
Fanconi Antibodies and Cancer Research We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | FANCD2 |