![Western Blot: ErbB2/Her2 Antibody [NBP1-84584] - Analysis in human cell line SK-BR-3.](http://images.novusbio.com/fullsize/ErbB2-Her2-Antibody-Western-Blot-NBP1-84584-img0006.jpg "Western Blot: ErbB2/Her2 Antibody [NBP1-84584] - Analysis in human cell line SK-BR-3.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ERBB2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Neutralization ErbB3/Her3 Antibody (66223) [Unconjugated]](https://images.novusbio.com/images2/ErbB3_MAB3481_Block_Neutralize_9158.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ErbB2/Her2 Antibody (NBP1-84584)Find related products by research area.
|
|
Unlocking the Potential of Biosimilars in Immuno-Oncology By Jennifer Jones, M.S.Biosimilar Antibodies: Imitation Meets InnovationIn the ever-evolving medical landscape, a new class of pharmaceuticals is emerging as a game-changer, poised to transform the way we approach... Read full blog post. |
|
NPC1: A Potential Target For Triple-Negative Breast Cancer By Natalia Gurule, PhD Breast Cancer is a Heterogeneous DiseaseBreast cancer is the most frequently identified malignancy in women, accounting for 30% of diagnosed cases of cancer in women in the US annuall... Read full blog post. |
|
Hypoxia-Dependent CAR Stabilizing Construct in T cells Improves Solid Tumor Targeting and Efficacy By Victoria Osinski, PhDDespite advances in the development of cancer immunotherapies, those specifically targeting tumors still remains limited. Currently, there is great interest in utilizing chimeric antigen rece... Read full blog post. |
|
Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERBB2 |
![Immunocytochemistry/Immunofluorescence: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human cell line MCF7 shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ErbB2-Her2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84584-img0008.jpg "Immunocytochemistry/Immunofluorescence: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human cell line MCF7 shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ErbB2-Her2-Antibody-Immunohistochemistry-Paraffin-NBP1-84584-img0013.jpg "Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human breast cancer shows no positivity in tumor cells as expected.](http://images.novusbio.com/fullsize/ErbB2-Her2-Antibody-Immunohistochemistry-Paraffin-NBP1-84584-img0010.jpg "Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human breast cancer shows no positivity in tumor cells as expected.")
![Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human breast cancer shows strong membranous positivity in tumor cells.](http://images.novusbio.com/fullsize/ErbB2-Her2-Antibody-Immunohistochemistry-Paraffin-NBP1-84584-img0011.jpg "Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human breast cancer shows strong membranous positivity in tumor cells.")
![Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human kidney shows weak to moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ErbB2-Her2-Antibody-Immunohistochemistry-Paraffin-NBP1-84584-img0012.jpg "Immunohistochemistry-Paraffin: ErbB2/Her2 Antibody [NBP1-84584] - Staining of human kidney shows weak to moderate granular cytoplasmic positivity in cells in tubules.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Immunocytochemistry ErbB4/Her4 Antibody (182803) [Unconjugated]](https://images.novusbio.com/images2/ErbB4_MAB1131_Immunocytochemistry__Immunofluorescence_21145.jpg)
![Immunohistochemistry ErbB4/Her4 Antibody (182803) [Unconjugated]](https://images.novusbio.com/images2/ErbB4_MAB1131_Immunohistochemistry_12968.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")