![Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Colonic levels of EphB4 and ephrin-B2 proteins. Representative western blots showing the expression of EphB4, ephrin-B2 and beta-actin proteins in lysates, obtained from the colon of vehicle-treated normal mice (N) and in TNBS-treated mice administered with vehicle (CNT) or EphB4 20 ug/kg (EphB4). Image collected and cropped by CiteAb from the following publication (//www.frontiersin.org/article/10.3389/fphar.2019.00691/full), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-Western-Blot-NBP1-84830-img0009.jpg "Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Colonic levels of EphB4 and ephrin-B2 proteins. Representative western blots showing the expression of EphB4, ephrin-B2 and beta-actin proteins in lysates, obtained from the colon of vehicle-treated normal mice (N) and in TNBS-treated mice administered with vehicle (CNT) or EphB4 20 ug/kg (EphB4). Image collected and cropped by CiteAb from the following publication (//www.frontiersin.org/article/10.3389/fphar.2019.00691/full), licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EFNB2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 21539827). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Ephrin-B2 Antibody (NBP1-84830)Find related products by research area.
|
|
Cytokeratin 18 - A Intermediate Filament Cyotskeletal Component Keratins, also called cytokeratins, are a family of filamentous structural proteins that form the intermediate filaments within epithelial cells. Keratins are differentially expressed depending on both the epithelial cell origin and degree of differen... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EFNB2 |
![Immunocytochemistry/Immunofluorescence: Ephrin-B2 Antibody [NBP1-84830] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84830-img0003.jpg "Immunocytochemistry/Immunofluorescence: Ephrin-B2 Antibody [NBP1-84830] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human placenta shows moderate membranous positivity in endothelial cells.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-Immunohistochemistry-Paraffin-NBP1-84830-img0008.jpg "Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human placenta shows moderate membranous positivity in endothelial cells.")
![Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-Western-Blot-NBP1-84830-img0002.jpg "Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Analysis in human cell line HEK 293.")
![Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human colon shows weak to moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-Immunohistochemistry-Paraffin-NBP1-84830-img0005.jpg "Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human colon shows weak to moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-Immunohistochemistry-Paraffin-NBP1-84830-img0006.jpg "Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.")
![Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human lung shows weak to moderate membranous positivity in pneumocytes.](http://images.novusbio.com/fullsize/Ephrin-B2-Antibody-Immunohistochemistry-Paraffin-NBP1-84830-img0007.jpg "Immunohistochemistry-Paraffin: Ephrin-B2 Antibody [NBP1-84830] - Staining of human lung shows weak to moderate membranous positivity in pneumocytes.")
![Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Colonic levels of EphB4 & ephrin-B2 mRNA. (A) Representative agarose gels showing mRNA levels of EphB4, ephrin-B2 & GAPDH from the colon of vehicle-treated normal mice (N; n = 7) & of TNBS-treated mice administered with vehicle (CNT; n = 4) or EphB4 20 µg/kg (EphB; n = 5). Histograms represent the quantification of EphB4 (B) & ephrin-B2 (C) mRNA levels normalized to GAPDH amplification products. Transcript X1 (black bars) & transcript X2 (white bars), encoded by ephrin-B2 gene, were detected & represented (C). Data are shown as mean ± SEM. *P < 0.05 vs. N mice, one-way ANOVA followed by Bonferroni’s post-test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31297055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-84830_rabbit-polyclonal-ephrin-b2-antibody-31020241539743.jpg "Western Blot: Ephrin-B2 Antibody [NBP1-84830] - Colonic levels of EphB4 & ephrin-B2 mRNA. (A) Representative agarose gels showing mRNA levels of EphB4, ephrin-B2 & GAPDH from the colon of vehicle-treated normal mice (N; n = 7) & of TNBS-treated mice administered with vehicle (CNT; n = 4) or EphB4 20 µg/kg (EphB; n = 5). Histograms represent the quantification of EphB4 (B) & ephrin-B2 (C) mRNA levels normalized to GAPDH amplification products. Transcript X1 (black bars) & transcript X2 (white bars), encoded by ephrin-B2 gene, were detected & represented (C). Data are shown as mean ± SEM. *P < 0.05 vs. N mice, one-way ANOVA followed by Bonferroni’s post-test. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31297055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Western_Blot_17606.jpg)
![Immunocytochemistry EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Immunocytochemistry__Immunofluorescence_20119.jpg)
![Western Blot Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphrinB1_AF473_Western_Blot_17536.jpg)
![Immunohistochemistry Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ephrin-B1_AF473_Immunohistochemistry_7180.jpg)
![Simple Western Ephrin-B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphrinB1_AF473_Simple_Western_18962.jpg)
![Western Blot Ephrin-B3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphrinB3_AF395_Western_Blot_16885.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![EphB1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "EphB1 [Unconjugated]")
![Immunocytochemistry EphB3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB3_AF432_Immunocytochemistry_10108.jpg)
![Western Blot EphB3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB3_AF432_Western_Blot_23994.jpg)
![Western Blot DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Western_Blot_15836.jpg)
![Immunocytochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunocytochemistry_15887.jpg)
![Immunohistochemistry DLL4 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL4_AF1389_Immunohistochemistry_24173.jpg)
![Immunohistochemistry Ephrin-A4 Antibody (135305) [Unconjugated]](https://images.novusbio.com/images2/EphrinA4_MAB369_Immunohistochemistry_21487.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Knockout_Validated_21256.jpg)
![Immunohistochemistry EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Immunohistochemistry_7327.jpg)
![Flow Cytometry EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Flow_Cytometry_20077.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")