Home » DYM » DYM Proteins » DYM Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DYM Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DYM Recombinant Protein Antigen (NBP2-55368PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DYM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DYM.

Source: E. coli

Amino Acid Sequence: RMMLEIINSCLTNSLHHNPNLVYALLYKRDLFEQFRTHPSFQDIMQNIDLVISFFSSRLLQAGAELSVERVLEIIKQGVVALPKDRLKKFPELKFKYV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DYM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55368.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DYM Recombinant Protein Antigen

  • DMCSMCFLJ20071
  • Dyggve-Melchior-Clausen syndrome protein
  • dymeclin
  • FLJ90130

Background

The DYM gene encodes for a protein that is critical for correct organization of Golgi apparatus and is involved in skeletal development and brain functioning. Isoform 1 of this protein is 669 amino acids long at nearly 76 kDA while isoform 2 is 479 amino acids long at approximately 54 kDA. DYM is known to interact with ACO2, C12orf4, SPAG9, GMPS, and TBC1D22B genes. Defects in the DYM gene are known to cause Dyggve-Melchior-Clausen syndrome as well as Smith-McCort Dysplasia. DYM has also been investigated for its role in various diseases such as thyroiditis, acromegaly, dwarfism, gangliosidosis, turner syndrome, atherosclerosis, microencephaly, intellectual disabilities, and sponastrime dysplasia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(384 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Rad21 Antibody
NBP2-20053
Immunohistochemistry-Paraffin Rad21 Antibody
Immunohistochemistry-Paraffin Rad21 Antibody
Immunocytochemistry/ Immunofluorescence Rad21 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Neurophysin
II/Arg-vasopressin An ...
AF009
Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]
Species: Hu
Applications: IHC, WB
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot GADD153/CHOP Antibody (9C8)
Flow Cytometry GADD153/CHOP Antibody (9C8)
Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)
(3 Reviews)
(45 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
SMC5 Antibody
NB100-469
Western Blot SMC5 Antibody
Immunoprecipitation SMC5 Antibody
(8 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
DLC1 Antibody -
Isoform 1 and 3
NB300-917
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunohistochemistry-Paraffin DLC1 Antibody - Isoform 1 and 3
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot Complement C4b/d Antibody (16D2)
(12 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Haptoglobin [HRP]
DHAPG0
N/A Haptoglobin [HRP]
N/A Haptoglobin [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
Nse2 Antibody -
BSA Free
NBP1-76263
Western Blot Nse2 Antibody - BSA Free
Western Blot Nse2 Antibody - BSA Free
Western Blot Nse2 Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, WB
SMC1 Antibody
NB100-204
Immunohistochemistry-Paraffin SMC1 Antibody
Immunohistochemistry-Paraffin SMC1 Antibody
Unknown SMC1 Antibody
(36 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P

Publications for DYM Recombinant Protein Antigen (NBP2-55368PEP) (0)

There are no publications for DYM Recombinant Protein Antigen (NBP2-55368PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYM Recombinant Protein Antigen (NBP2-55368PEP) (0)

There are no reviews for DYM Recombinant Protein Antigen (NBP2-55368PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DYM Recombinant Protein Antigen (NBP2-55368PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DYM Products

Array NBP2-55368PEP

Blogs on DYM

There are no specific blogs for DYM, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DYM Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DYM