Novus Biologicals products are now on bio-techne.com

DNAJB6 Recombinant Protein Antigen

Name: DNAJB6 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-49286PEP
Price: 279 USD

Images

There are currently no images for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DNAJB6 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJB6. Source: E. coli Amino Acid Sequence: VADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	DNAJB6
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49286. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAJB6 Recombinant Protein Antigen

DJ4
DKFZp566D0824
DnaJ (Hsp40) homolog, subfamily B, member 6
dnaJ homolog subfamily B member 6
DnaJ
DnaJ-like 2 protein
FLJ42837
Heat shock protein J2
HHDJ1
HSJ2
HSJ-2
MGC1152
MRJMGC117297
MSJ1
MSJ-1

Background

DNAJB6 encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HspA4 Antibody

NBP1-81696

Immunohistochemistry-Paraffin HspA4 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HSP40/DNAJB1
Antibody (OTI1F9)

NBP2-03433

Immunocytochemistry/ Immunofluorescence HSP40/DNAJB1 Antibody (OTI1F9)

Immunohistochemistry-Paraffin HSP40/DNAJB1 Antibody (OTI1F9)

Species: Ca, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

HSP60 Antibody -
BSA Free

NBP1-77397

(4 Reviews)

(6 Publications)

Species: Hu, Mu

Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB

HSP10/EPF Antibody
(0H0X6)

NBP3-16604

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

HSPA8/HSC71/Hsc70
Antibody (13D3)

NB120-2788

(2 Reviews)

(28 Publications)

Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt

Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

HDJ2 Antibody

NBP1-88019

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KD, WB

GRP78/HSPA5
Antibody - BSA Free

NBP1-06274

Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free

(2 Reviews)

(44 Publications)

Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze

Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB

TID1 Antibody

NBP1-33387

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

BMP-3b/GDF-10
Antibody [Unconjugate

AF1543

(1 Publication)

Species: Hu

Applications: IHC, WB

CLPB Antibody

NBP2-32629

Species: Hu

Applications: IHC, IHC-P, WB

Perforin Antibody
(CB5.4) - BSA Free

NBP1-97512

(7 Publications)

Species: Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

B3GALNT1 Antibody
- BSA Free

NBP2-92677

Species: Hu, Mu, Rt

Applications: WB

NUCKS1 Antibody

NB100-74635

Species: Hu

Applications: IHC, IHC-P, IP, WB (-)

Protamine 1
Antibody

NBP2-30949

Species: Hu

Applications: IHC, IHC-P

PMEL17/SILV
Antibody (HMB45)

NBP2-44520

Immunohistochemistry PMEL17/SILV Antibody (HMB45)

(8 Publications)

Species: Ca(-), Hu, Rt(-)

Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB

RPLP1 Antibody

NBP1-81293

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

HSP90 alpha
Antibody

NB120-2928

Immunohistochemistry-Paraffin HSP90 alpha Antibody

(13 Publications)

Species: Hu, Mu, Pm, Rb, Rt, Sh

Applications: ICC/IF, IHC, IHC-P, IP, WB

CD77 Synthase
Antibody

NBP1-62583

(2 Publications)

Species: Hu

Applications: WB

DNAJA2 Antibody
(OTI3A10)

NBP2-02996

Immunohistochemistry-Paraffin DNAJA2 Antibody (OTI3A10)

Species: Ca, Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

DNAJB6 Recombinant
Protein Antigen

NBP2-49286PEP

Species: Hu

Applications: AC

Publications for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP) (0)

There are no publications for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP) (0)

There are no reviews for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNAJB6 Products

Blogs on DNAJB6

There are no specific blogs for DNAJB6, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on Jurkat cells with Alexa Fluor 647 conjugate of GPR78/HSPA5 antibody NBP1-06274AF647 (blue) and a matched isotype control NBP2-24893AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.

GRP78/HSPA5 Antibody - BSA Free
NBP1-06274

Immunocytochemistry/Immunofluorescence: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with a HSP70 monoclonal antibody at a dilution of 1:50 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488 goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.

HSPA8/HSC71/Hsc70 Antibody (13D3)
NB120-2788

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our DNAJB6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

DNAJB6

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

DNAJB6 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

DNAJB6 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for DNAJB6 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP) (0)

Reviews for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP) (0)

FAQs for DNAJB6 Recombinant Protein Antigen (NBP2-49286PEP) (0)

Additional DNAJB6 Products

Blogs on DNAJB6

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics