Home » Dlx6 » Dlx6 Proteins » Dlx6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Dlx6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Dlx6 Protein (NBP1-85929PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Dlx6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DLX6.

Source: E. coli

Amino Acid Sequence: ALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DLX6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85929.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dlx6 Recombinant Protein Antigen

  • distal-less homeo box 6
  • distal-less homeobox 6
  • homeobox protein DLX-6
  • MGC125282
  • MGC125283
  • MGC125284
  • MGC125285

Background

Dlx6 encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DLX5 Antibody
NBP1-85793
Immunocytochemistry/ Immunofluorescence DLX5 Antibody
Immunohistochemistry-Paraffin DLX5 Antibody
Immunohistochemistry-Paraffin DLX5 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DLX2 Antibody
(HL1942) - Azide and ...
NBP3-25440
Western Blot DLX2 Antibody (HL1942) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence DLX2 Antibody (HL1942) - Azide and BSA Free
Western Blot DLX2 Antibody (HL1942) - Azide and BSA Free
Species: Hu, Rt
Applications: ICC/IF, WB
Dlx1 Antibody (2H3)
H00001745-M01
Sandwich ELISA Dlx1 Antibody (2H3)
Western Blot Dlx1 Antibody (2H3)
Western Blot Dlx1 Antibody (2H3)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
HAND2 Antibody
[Unconjugated]
AF3876
Immunohistochemistry HAND2 Antibody [Unconjugated]
(5 Publications)
Species: Hu, Mu
Applications: IHC, WB
Endothelin-1 [HRP]
QET00B
N/A Endothelin-1 [HRP]
N/A Endothelin-1 [HRP]
(45 Publications)
Species: Hu
Applications: ELISA
DLX3 Antibody
NBP2-24646
Immunohistochemistry-Paraffin DLX3 Antibody
Western Blot DLX3 Antibody
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IHC, IHC-P, WB
MeCP2 Antibody
NB100-56326
Western Blot MeCP2 Antibody
Immunocytochemistry/ Immunofluorescence MeCP2 Antibody
Immunohistochemistry-Paraffin MeCP2 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
BP1 Antibody
NB100-481
Western Blot BP1 Antibody
Western Blot BP1 Antibody
Immunohistochemistry-Frozen BP1 Antibody
(1 Review)
(7 Publications)
Species: Hu
Applications: ChIP, IHC, IHC-Fr, IHC-P, IP, WB
SS18L1 Antibody
NBP2-20486
Immunoprecipitation SS18L1 Antibody
Immunohistochemistry-Paraffin SS18L1 Antibody
Immunocytochemistry/ Immunofluorescence SS18L1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
EDNRA/Endothelin R
Type A Antibody
NB600-836
Immunocytochemistry/ Immunofluorescence EDNRA/Endothelin R Type A Antibody
Western Blot EDNRA/Endothelin R Type A Antibody
Western Blot EDNRA/Endothelin R Type A Antibody
(1 Review)
(4 Publications)
Species: Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MSX2 Antibody
NBP1-85445
Immunohistochemistry-Paraffin MSX2 Antibody
Immunohistochemistry-Paraffin MSX2 Antibody
Immunohistochemistry-Paraffin MSX2 Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
p63/TP73L Antibody
[Unconjugated]
AF1916
Immunohistochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]
(1 Review)
(23 Publications)
Species: Hu
Applications: ICC, IHC, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
Immunohistochemistry beta-Galactosidase-1/GLB1 Antibody (OTI1C9)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
CKAP4/p63 Antibody
[Unconjugated]
AF7355
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
Western Blot CKAP4/p63 Antibody [Unconjugated]
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
MSX1 Antibody
[Unconjugated]
AF5045
Western Blot MSX1 Antibody [Unconjugated]
Immunohistochemistry MSX1 Antibody [Unconjugated]
Western Blot MSX1 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: IHC, WB
BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
Dlx6 Recombinant
Protein Antigen
NBP1-85929PEP
Dlx6 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Dlx6 Protein (NBP1-85929PEP) (0)

There are no publications for Dlx6 Protein (NBP1-85929PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dlx6 Protein (NBP1-85929PEP) (0)

There are no reviews for Dlx6 Protein (NBP1-85929PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dlx6 Protein (NBP1-85929PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dlx6 Products

Research Areas for Dlx6 Protein (NBP1-85929PEP)

Find related products by research area.

Blogs on Dlx6

There are no specific blogs for Dlx6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dlx6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DLX6