Reactivity | Hu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clone | 4A3H6 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-285 of human Cytosolic Sulfotransferase 2A1/SULT2A1 (Q06520). LLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | SULT2A1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (NBP3-16665)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SULT2A1 |