Home » Cytokeratin 7 » Cytokeratin 7 Proteins » Cytokeratin 7 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Cytokeratin 7 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88919PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Cytokeratin 7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cytokeratin 7.

Source: E. coli

Amino Acid Sequence: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G).

Source: E. coli

Amino Acid Sequence: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KRT7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-88919.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Alternate Names for Cytokeratin 7 Recombinant Protein Antigen

  • CK7
  • CK-7
  • cytokeratin 7
  • cytokeratin-7
  • K2C7
  • K7keratin, 55K type II cytoskeletal
  • keratin 7
  • keratin, type II cytoskeletal 7
  • keratin-7
  • MGC129731
  • MGC3625
  • sarcolectin
  • SCLkeratin, simple epithelial type I, K7
  • type II mesothelial keratin K7
  • Type-II keratin Kb7

Background

Cytokeratin 7 is a 54kD intermediate filament protein found in a variety of glandularepithelia. Cytokeratin 7 has been found in columnar and glandular epithelium of the lung, cervix, breast, bile ducts and larger collecting ducts of the kidney. It is present in the transitional epithelium of bladder as well as ovarian and lungepithelia, and occasionally staining of blood vessel cell walls, particularly endothelial cells, may be observed. However, Cytokeratin 7 is not expressed by epithelial cells of the gastrointestinal tract, colon or prostate. Keratin 7 is often co expressed with keratin 19.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Cytokeratin 19
Antibody - BSA Free
NB100-687
Flow Cytometry Cytokeratin 19 Antibody - BSA Free
Western Blot Cytokeratin 19 Antibody - BSA Free
Immunohistochemistry Cytokeratin 19 Antibody - BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(69 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MUC1 Antibody -
BSA Free
NBP1-60046
Knockout Validated MUC1 Antibody - BSA Free
Knockout Validated MUC1 Antibody - BSA Free
Chromatin Immunoprecipitation MUC1 Antibody - BSA Free
(8 Publications)
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Choline kinase
alpha Antibody
NBP1-85630
Western Blot Choline kinase alpha Antibody
Immunohistochemistry-Paraffin Choline kinase alpha Antibody
Immunohistochemistry-Paraffin Choline kinase alpha Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Choline Kinase
beta [Unconjugated]
8184-CK
Choline Kinase beta [Unconjugated]
Species: Hu
Applications: EnzAct
SCL/Tal1 Antibody
(OTI5H1)
NBP2-01488
Western Blot SCL/Tal1 Antibody (OTI5H1)
Flow Cytometry SCL/Tal1 Antibody (OTI5H1)
Immunocytochemistry/ Immunofluorescence SCL/Tal1 Antibody (OTI5H1)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Cytokeratin 8
Antibody
NBP2-16094
Immunocytochemistry/ Immunofluorescence Cytokeratin 8 Antibody
Western Blot Cytokeratin 8 Antibody
Immunohistochemistry-Paraffin Cytokeratin 8 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, KO, WB
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
Immunohistochemistry CEACAM7 Antibody [Unconjugated]
Western Blot CEACAM7 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
Recombinant Human
PSG2 GST (N-Term) Pro ...
H00005670-Q01
SDS-PAGE Recombinant Human PSG2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Cytokeratin 14
Antibody (LL002)
NBP2-34270
Flow Cytometry Cytokeratin 14 Antibody (LL002)
Immunocytochemistry/ Immunofluorescence Cytokeratin 14 Antibody (LL002)
Immunohistochemistry-Paraffin Cytokeratin 14 Antibody (LL002)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
RNA polymerase I
termination factor An ...
NBP3-27122
Immunohistochemistry RNA polymerase I termination factor Antibody (2F4D8)
Western Blot RNA polymerase I termination factor Antibody (2F4D8)
ELISA RNA polymerase I termination factor Antibody (2F4D8)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GATA-1 Antibody
(4F5) - BSA Free
NBP1-47492
Immunohistochemistry GATA-1 Antibody (4F5) - BSA Free
Immunocytochemistry/ Immunofluorescence GATA-1 Antibody (4F5) - BSA Free
Immunohistochemistry-Paraffin GATA-1 Antibody (4F5) - BSA Free
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(39 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ETFA Antibody
NBP1-84854
Immunocytochemistry/ Immunofluorescence ETFA Antibody
Immunohistochemistry-Paraffin ETFA Antibody
Immunohistochemistry-Paraffin ETFA Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Cytokeratin 5
Antibody - BSA Free
NBP2-61931
Immunocytochemistry/ Immunofluorescence Cytokeratin 5 Antibody - BSA Free
Western Blot Cytokeratin 5 Antibody - BSA Free
Immunohistochemistry-Paraffin Cytokeratin 5 Antibody - BSA Free
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cytokeratin 7
Recombinant Protein A ...
NBP2-88919PEP
Cytokeratin 7 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88919PEP) (0)

There are no publications for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88919PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88919PEP) (0)

There are no reviews for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88919PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88919PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytokeratin 7 Products

Research Areas for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88919PEP)

Find related products by research area.

Blogs on Cytokeratin 7

There are no specific blogs for Cytokeratin 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody
NB300-223
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cytokeratin 7 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KRT7